FC875262

Overview
NameFC875262
Unique NameFC875262
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length732
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig7777 contig Ccv1_Contig7777:844..1575. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: SPOR1_IPOBA (Sporamin A OS=Ipomoea batatas PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.923e-11
Identity = 53/184 (28.80%), Postives = 88/184 (47.83%), Query Frame = 2
Query:  116 PLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFR-GRNELCPLDVVQLSSDSERGTRLRF---SMYDKTSIINEDVDLNVRFSTETR--CNEPTVWRVDSYDPSRGKWFITTGG-VEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSNDH---ARRLALTNGRALAVV 637
            P++D+NG++V A  +YY+VSAI GAGG GL L        C  DV+   +D + G  +     +   +++++        RF+  T   C     W +  +D + G++F+  G  V  N       N FK E +  +  +YK+ +C    + C     +VG  +DH     RLAL+N   + V+
Sbjct:   42 PVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNWGI-QHDSASGQYFLKAGEFVSDN------SNQFKIELVDANLNSYKLTYCQFGSDKCY----NVGRFHDHMLRTTRLALSNSPFVFVI 214          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: SPI5_SOLTU (Serine protease inhibitor 5 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.923e-11
Identity = 61/197 (30.96%), Postives = 93/197 (47.21%), Query Frame = 2
Query:   80 TFATKPLVGL---ADPLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNELCPL--DVVQLSSD-SERGTRLRF---SMYDKTSIINEDVDLNVRF--STETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSNDHA-RRLALTNGRALAV 634
            TF ++  + L   A P++DV G +++    Y ++S  RGA G  + L +  N   P    V + +SD    GT +RF   S +    I   ++ LN++F  ST   C   T+W+V  YD S G   + TGG  G    Q   +WFK   +   +  Y +++CP   +     C  VGV + +  RRLAL     L V
Sbjct:   20 TFTSQNPINLPSDATPVLDVTGKELDPRLSYRIISIGRGALGGDVYLGKSPNSDAPCANGVFRFNSDVGPSGTPVRFIGSSSHFGPHIFEGEL-LNIQFDISTVKLCVSYTIWKVGDYDASLGTMLLETGGTIG----QADSSWFKI--VKSSQLGYNLLYCPFSSDD--QFCLKVGVVHQNGKRRLALVKDNPLDV 207          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: IDE3_ERYLA (Trypsin inhibitor DE-3 OS=Erythrina latissima PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.923e-11
Identity = 51/177 (28.81%), Postives = 84/177 (47.46%), Query Frame = 2
Query:  119 LVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSMYDKTSIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNW-FKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSNDHA--RRLALTNGRALAVVL 640
            L+D NG  V+    YYL+  +   GG G+ L +   E CPL VVQ  ++   G  +R     +++ I +D ++ + F+   +C  P+ W     D   G        V+ +    T  ++ FKFE++     +YK+++C    E C S    +G++ D    RRL +T    L VVL
Sbjct:    2 LLDGNGEVVQNGGTYYLLPQVWAQGG-GVQLAKTGEETCPLTVVQSPNELSDGKPIRIESRLRSTFIPDDDEVRIGFAYAPKC-APSPWWTVVEDEQEGL------SVKLSEDESTQFDYPFKFEQVSDKLHSYKLLYCEGKHEKCAS----IGINRDQKGYRRLVVTEDNPLTVVL 166          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: IDE3_ERYVA (Trypsin inhibitor DE-3 OS=Erythrina variegata PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 9.042e-11
Identity = 51/177 (28.81%), Postives = 83/177 (46.89%), Query Frame = 2
Query:  119 LVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSMYDKTSIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNW-FKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSNDHA--RRLALTNGRALAVVL 640
            L+D NG  V+    YYL+  +   GG G+ L +   E CPL VVQ  ++   G  +R     +++ I +D  + + F+   +C  P+ W     D   G        V+ +    T  ++ FKFE++     +YK+++C    E C S    +G++ D    RRL +T    L VVL
Sbjct:    2 LLDGNGEVVQNGGTYYLLPQVWAQGG-GVQLAKTGEETCPLTVVQSPNELSNGKPIRIESRLRSAFIPDDDKVRIGFAYAPKC-APSPWWTVLEDEQEGL------SVKLSEDESTQFDYPFKFEQVSDKLHSYKLLYCEGKHEKCAS----IGINRDQKGYRRLVVTEDNPLTVVL 166          
The following BLAST results are available for this feature:
BLAST of FC875262 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
SPOR1_IPOBA6.923e-1128.80Sporamin A OS=Ipomoea batatas PE=2 SV=1[more]
SPI5_SOLTU6.923e-1130.96Serine protease inhibitor 5 OS=Solanum tuberosum P... [more]
IDE3_ERYLA6.923e-1128.81Trypsin inhibitor DE-3 OS=Erythrina latissima PE=1... [more]
IDE3_ERYVA9.042e-1128.81Trypsin inhibitor DE-3 OS=Erythrina variegata PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402A05EF CTVClemen1 Citrus clementina cDNA clone C31402A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875262 ID=FC875262|Name=FC875262|organism=Citrus clementina|type=EST|length=732bp
AAGTACTCACTCAATCAGCTCTCTGAAAGATAACAAAATGAGTACTCCTT
TTGTAACTGCAATCTCCTTCCTTGTCCTTACCTTTGCCACAAAACCGCTT
GTGGGACTCGCTGATCCTTTGGTTGATGTCAATGGCAACAAGGTCGAAGC
ATCCCGAGACTACTATTTGGTCTCAGCAATTCGAGGAGCAGGCGGCAGCG
GCCTCACCCTCTTCAGGGGCAGAAACGAACTCTGCCCACTTGATGTTGTC
CAACTAAGTTCCGACTCAGAAAGAGGAACCCGTTTAAGATTCTCAATGTA
TGATAAAACTAGTATTATCAATGAAGATGTGGATCTGAACGTGAGATTCT
CGACAGAGACTCGCTGCAACGAACCAACAGTATGGAGAGTCGACAGCTAT
GATCCATCGAGAGGAAAATGGTTTATAACAACTGGTGGTGTTGAAGGAAA
CCCTGGAGCTCAAACTTTGAAAAACTGGTTTAAGTTTGAGAGAATTGGAG
GAGATCGAGCTACGTACAAGATTGTTCACTGTCCTTCCGTTTGCGAATCC
TGTGTATCTTTATGCAATGATGTTGGGGTTTCTAACGATCATGCTCGACG
TTTGGCTCTCACTAACGGGCGCGCGCTTGCTGTTGTTCTAGTCCCTGGTA
ATGAGAGATCAGCCTCATGTGCGTCTTGAATGCCCTTGTATCATTACTCT
AAATATGGATCGGGCTAGCTCCTGACGCTTAT
back to top