FC875266

Overview
NameFC875266
Unique NameFC875266
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length673
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875266_ssr29 microsatellite FC875266_ssr29:29..44. BLAST: Citrus ESTs to Prunus persica proteins V1
FC875266_ssr130 microsatellite FC875266_ssr130:130..141. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10192 contig Ccv1_Contig10192:1..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL2F_ARATH (RING-H2 finger protein ATL2F OS=Arabidopsis thaliana GN=ATL2F PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.915e-25
Identity = 49/94 (52.13%), Postives = 70/94 (74.47%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETT---PQPSELGSS 666
            LD  +I++FPTF+YS+VK  ++G G +ECAVC+ EFED ETLRL+P+C HVFH +C+  WL  H+TCP+CR +L  +PGE +   P+P  + S+
Sbjct:   68 LDEAIINSFPTFLYSEVKERRIGIGGVECAVCICEFEDHETLRLMPECCHVFHADCVSVWLSDHSTCPLCRVDLCLQPGERSYLNPEPDLVEST 161          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4A_ARATH (RING-H2 finger protein ATL4A OS=Arabidopsis thaliana GN=ATL4A PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.589e-22
Identity = 42/74 (56.76%), Postives = 57/74 (77.03%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNL 615
            LD E I +FP+FVY++ + ++ G G LEC VCLNEF+DDETLRL+P C HVFH +C+D WL   +TCP+CR+ +
Sbjct:   57 LDAEAIKSFPSFVYTEARGIEPGIGELECVVCLNEFKDDETLRLVPPCVHVFHADCVDIWLSHSSTCPICRAKV 130          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4I_ARATH (Putative RING-H2 finger protein ATL4I OS=Arabidopsis thaliana GN=ATL4I PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.678e-21
Identity = 46/86 (53.49%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQPS 651
            L+  +I++FPTF YS VK L+  K  LECA+CL EF+ D  LRL+  C HVFH ECID W ESH TCPVCR +L   P     +P+
Sbjct:   82 LELRIINSFPTFPYSSVKDLREEKYGLECAICLLEFDGDHVLRLLTTCYHVFHQECIDLWFESHRTCPVCRRDLDPPPPPENTKPT 167          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL2C_ARATH (Putative RING-H2 finger protein ATL2C OS=Arabidopsis thaliana GN=ATL2C PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.571e-19
Identity = 42/76 (55.26%), Postives = 53/76 (69.74%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLAS 621
            +D+ +IDT P F Y  +  LK+     +C VCL EFE ++ LRL+PKC H FH ECID WL SH+TCP+CRSNL S
Sbjct:  100 VDQSLIDTLPVFHYKSIVGLKISP--FDCPVCLCEFETEDKLRLLPKCSHAFHVECIDTWLLSHSTCPLCRSNLLS 173          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4K_ARATH (RING-H2 finger protein ATL4K OS=Arabidopsis thaliana GN=ATL4K PE=2 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 2.268e-18
Identity = 41/77 (53.25%), Postives = 53/77 (68.83%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASE 624
            +D+  IDT P F Y  +  LK      +CAVCL EFE ++ LRL+PKC H FH +CID WL SH+TCP+CRS+L S+
Sbjct:  108 VDQSFIDTLPVFHYKSIIGLK--NYPFDCAVCLCEFETEDKLRLLPKCSHAFHMDCIDTWLLSHSTCPLCRSSLLSD 182          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL2D_ARATH (Putative RING-H2 finger protein ATL2D OS=Arabidopsis thaliana GN=ATL2D PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.268e-18
Identity = 42/77 (54.55%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASE 624
            LD++ I++ P F +S +K LK G   LEC+VCL++FED E LRL+PKC H FH  CID WLE H TCP+CR+ +  E
Sbjct:   99 LDKKAIESLPFFRFSALKGLKQG---LECSVCLSKFEDVEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRNRVNIE 172          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5L_ARATH (Putative RING-H2 finger protein ATL5L OS=Arabidopsis thaliana GN=ATL5L PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.869e-18
Identity = 42/75 (56.00%), Postives = 53/75 (70.67%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETL-RLIPKCDHVFHPECIDAWLESHTTCPVCRSNL 615
            L+  +I ++P F +S VK L+  K  LECA+CL EFE++  L RL+  C HVFH ECID WLES+ TCPVCR NL
Sbjct:   86 LEPHIIQSYPLFPFSSVKDLREDKYGLECAICLLEFEEEHILLRLLTTCYHVFHQECIDQWLESNKTCPVCRRNL 160          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL2E_ARATH (RING-H2 finger protein ATL2E OS=Arabidopsis thaliana GN=ATL2E PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 8.618e-18
Identity = 50/143 (34.97%), Postives = 73/143 (51.05%), Query Frame = 1
Query:  286 MGFFSIYIRHCSDSSNSVIXXXXXXXXXXXXXXXXXLDREVIDTFPTF--------------VYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSN-LASEPGETTPQPSELGSSE 669
            MGFFS+Y RH +DSS+S +                 L   V+ + P                VY   K  K  +   +C +CL++FE+ ET+++IP C HVFH +C+D WL S+ TCP+CRSN L S+      +P +  S+E
Sbjct:   64 MGFFSVYFRHFADSSSSTVDISSMPRTRSSRMSPRRLSTSVVVSRPYSFRRGLDSQAVRSLPVYRYTKAAK--QRNEDCVICLSDFEEGETVKVIPHCGHVFHVDCVDTWLSSYVTCPLCRSNQLFSDKDLGMQEPPDQDSAE 204          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL3F_ARATH (RING-H2 finger protein ATL3F OS=Arabidopsis thaliana GN=ATL3F PE=2 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 1.126e-17
Identity = 40/79 (50.63%), Postives = 52/79 (65.82%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPG 630
            LD  VI + P F +SD    +  K  +ECAVCL+EFE+ ET R++P C H FH +CID W  SH+TCP+CRS + S  G
Sbjct:   95 LDPNVIKSLPVFTFSD----ETHKDPIECAVCLSEFEESETGRVLPNCQHTFHVDCIDMWFHSHSTCPLCRSLVESLAG 169          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5C_ARATH (RING-H2 finger protein ATL5C OS=Arabidopsis thaliana GN=ATL5C PE=2 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 2.508e-17
Identity = 39/77 (50.65%), Postives = 50/77 (64.94%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASE 624
            +DR VI++ P F +     L   K  LECAVCL  FE  E LRL+PKC H FH EC+D WL++H+TCP+CR  +  E
Sbjct:  121 IDRSVIESLPVFRFG---ALSGHKDGLECAVCLARFEPTEVLRLLPKCKHAFHVECVDTWLDAHSTCPLCRYRVDPE 194          
The following BLAST results are available for this feature:
BLAST of FC875266 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
ATL2F_ARATH1.915e-2552.13RING-H2 finger protein ATL2F OS=Arabidopsis thalia... [more]
ATL4A_ARATH2.589e-2256.76RING-H2 finger protein ATL4A OS=Arabidopsis thalia... [more]
ATL4I_ARATH1.678e-2153.49Putative RING-H2 finger protein ATL4I OS=Arabidops... [more]
ATL2C_ARATH1.571e-1955.26Putative RING-H2 finger protein ATL2C OS=Arabidops... [more]
ATL4K_ARATH2.268e-1853.25RING-H2 finger protein ATL4K OS=Arabidopsis thalia... [more]
ATL2D_ARATH2.268e-1854.55Putative RING-H2 finger protein ATL2D OS=Arabidops... [more]
ATL5L_ARATH3.869e-1856.00Putative RING-H2 finger protein ATL5L OS=Arabidops... [more]
ATL2E_ARATH8.618e-1834.97RING-H2 finger protein ATL2E OS=Arabidopsis thalia... [more]
ATL3F_ARATH1.126e-1750.63RING-H2 finger protein ATL3F OS=Arabidopsis thalia... [more]
ATL5C_ARATH2.508e-1750.65RING-H2 finger protein ATL5C OS=Arabidopsis thalia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402A10EF CTVClemen1 Citrus clementina cDNA clone C31402A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875266 ID=FC875266|Name=FC875266|organism=Citrus clementina|type=EST|length=673bp
GATTTTCACAAATCTCACCGCCTCCTTGCTCTCTCTCTCTCTCTTTCCAA
CTCTCTCTCCACATCTCATGCAATAATGGGGTCACGACTCTTACCCTACT
CCGCGAAACATGGGACCAATCCCCTTTCTCTCCTCCTCCTCATGCTCCTC
GTCGCCAACGCGCTCCCCCTCCCGCTCGCCCAGCGCAGCCCCGAGTCCCC
GGGCTCCGTCGACCCCTACTCCAACATGAAATTCAGCCCCTCACTCGCCA
TAATAATCGTCGTGTTGATTTCGGCTCTCTTCTTCATGGGCTTCTTCTCC
ATCTACATCCGCCACTGCTCCGACTCCAGCAACTCCGTCATCCGCCCCTC
CGGCGCCGGAGGCAACCGCTCCAGGCGCGGCGCCGCCCGTGGCCTCGACC
GCGAGGTCATCGACACTTTCCCGACCTTCGTCTACTCCGACGTCAAGACG
CTGAAGGTCGGCAAAGGCGCGCTCGAGTGCGCCGTCTGCCTGAACGAGTT
CGAGGACGACGAAACGCTGCGTTTGATCCCGAAATGCGACCACGTCTTCC
ACCCCGAGTGTATCGACGCCTGGCTTGAATCGCACACCACGTGTCCCGTT
TGCCGCTCGAATTTGGCCTCTGAACCCGGTGAGACAACTCCTCAACCCAG
TGAGCTGGGCTCATCCGAGGTGG
back to top