FC875266

Overview
NameFC875266
Unique NameFC875266
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length673
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875266_ssr29 microsatellite FC875266_ssr29:29..44. BLAST: Citrus ESTs to Prunus persica proteins V1
FC875266_ssr130 microsatellite FC875266_ssr130:130..141. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10192 contig Ccv1_Contig10192:1..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5I_ARATH (RING-H2 finger protein ATL5I OS=Arabidopsis thaliana GN=ATL5I PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.347e-15
Identity = 40/92 (43.48%), Postives = 52/92 (56.52%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGA-------LECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQP 648
            LD+  ID  P F Y ++     G G         +CAVCL EF + + LRL+P C H FH  CID WL+S++TCP+CR  L S PG +   P
Sbjct:  108 LDQAFIDALPVFHYKEIVGSAGGGGGNGAAQEPFDCAVCLCEFSEKDKLRLLPMCSHAFHLNCIDTWLQSNSTCPLCRGTLFS-PGFSMENP 198          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL3J_ARATH (RING-H2 finger protein ATL3J OS=Arabidopsis thaliana GN=ATL3J PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.347e-15
Identity = 36/87 (41.38%), Postives = 54/87 (62.07%), Query Frame = 1
Query:  406 VIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQPSELGSS 666
            V+D+ P F +S V        + +CAVCL++FE ++ LRL+P C H FH +CID WL S+ TCP+CRS L +   +     + +GS+
Sbjct:   93 VLDSLPIFKFSSVTRRSSSMNSGDCAVCLSKFEPEDQLRLLPLCCHAFHADCIDIWLVSNQTCPLCRSPLFASESDLMKSLAVVGSN 179          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4G_ARATH (RING-H2 finger protein ATL4G OS=Arabidopsis thaliana GN=ATL4G PE=2 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 4.003e-15
Identity = 37/91 (40.66%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQPSELGSS 666
            L+  +I + P F +S V  L     A+EC+VCL+EF+D+E+ R++P C H FH  CID W  SH++CP+CRS +    G       E+  S
Sbjct:   52 LNPSIIKSLPIFTFSAVTALF----AMECSVCLSEFKDNESGRVMPNCKHTFHVHCIDMWFHSHSSCPLCRSQIEPFAGGVKSSMDEVAIS 138          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1A_ARATH (RING-H2 finger protein ATL1A OS=Arabidopsis thaliana GN=ATL1A PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.003e-15
Identity = 36/85 (42.35%), Postives = 51/85 (60.00%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLK----VGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGET 636
            LD   I   P F +     +       K + EC+VCLNEF++DE LR+IP C HVFH +CID WL+ +  CP+CR++++ E   T
Sbjct:  102 LDESAIRAIPVFKFKKRDVVAGEEDQSKNSQECSVCLNEFQEDEKLRIIPNCCHVFHIDCIDIWLQGNANCPLCRTSVSCEASFT 186          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL3G_ARATH (RING-H2 finger protein ATL3G OS=Arabidopsis thaliana GN=ATL3G PE=2 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 5.228e-15
Identity = 41/90 (45.56%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTL---KVGKGAL----ECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTP 642
            LD  VI T P F+YS         VGK +     +CAVCL EFE+ + +R +P C H FH ECID WL SH  CP+CR+ +    G  TP
Sbjct:  121 LDDSVIKTLPLFLYSAAACTGKPAVGKTSAANCRDCAVCLLEFEEGDYVRTLPLCFHAFHLECIDEWLRSHPNCPLCRTAILGSAGVLTP 210          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5N_ARATH (Putative RING-H2 finger protein ATL5N OS=Arabidopsis thaliana GN=ATL5N PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.521e-14
Identity = 35/74 (47.30%), Postives = 47/74 (63.51%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNL 615
            +D+  ID  P   Y  +  L+      +CAVCL EF  ++ LRL+PKC H FH ECID WL +++TCP+CR NL
Sbjct:   96 IDQSFIDALPLLHYKTMIGLR--HDLSDCAVCLREFTAEDELRLLPKCSHAFHVECIDTWLLTNSTCPLCRDNL 167          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4H_ARATH (Putative RING-H2 finger protein ATL4H OS=Arabidopsis thaliana GN=ATL4H PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.389e-14
Identity = 31/58 (53.45%), Postives = 43/58 (74.14%), Query Frame = 1
Query:  475 ECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQP 648
            +C++CL EF +DE+LRL+PKC+H FH  CID WL+SH+ CP+CR+ +      TT QP
Sbjct:  180 DCSICLGEFNEDESLRLLPKCNHTFHVVCIDRWLKSHSNCPLCRAKIIV---PTTQQP 234          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4E_ARATH (RING-H2 finger protein ATL4E OS=Arabidopsis thaliana GN=ATL4E PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.389e-14
Identity = 35/92 (38.04%), Postives = 57/92 (61.96%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPG-ETTPQPSELGSS 666
            L +++ +  P  +Y +   +K      +C+VCL +++ +E L+ +P C H FH ECID WL SHTTCP+CR +L  +P  + + Q +E+ SS
Sbjct:   87 LSKDIREMLPVVIYKESFIVKDS----QCSVCLGDYQAEEKLQQMPSCGHTFHMECIDLWLTSHTTCPLCRLSLIPKPSLDLSHQSTEIVSS 174          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL3E_ARATH (Putative RING-H2 finger protein ATL3E OS=Arabidopsis thaliana GN=ATL3E PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.389e-14
Identity = 30/61 (49.18%), Postives = 42/61 (68.85%), Query Frame = 1
Query:  463 KGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQ 645
            K  LEC VCL+E  D +  R++P CDH FH ECID+WL+S++TCP+CR  +  +   T P+
Sbjct:   83 KYVLECVVCLSELADGDKARVLPSCDHWFHVECIDSWLQSNSTCPICRKRVCLKQSRTRPE 143          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL2K_ARATH (RING-H2 finger protein ATL2K OS=Arabidopsis thaliana GN=ATL2K PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.389e-14
Identity = 36/87 (41.38%), Postives = 48/87 (55.17%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQPSE 654
            LD  VI + PTFV      +K      ECAVCL+  E+ +  R++P C HVFH  C+D WL + +TCPVCR+          P+P E
Sbjct:   76 LDSLVIASLPTFVVG----IKNDVAGTECAVCLSLLEEKDNARMLPNCKHVFHVSCVDTWLTTQSTCPVCRTEAEPSHPRLEPEPRE 158          
The following BLAST results are available for this feature:
BLAST of FC875266 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
ATL5I_ARATH2.347e-1543.48RING-H2 finger protein ATL5I OS=Arabidopsis thalia... [more]
ATL3J_ARATH2.347e-1541.38RING-H2 finger protein ATL3J OS=Arabidopsis thalia... [more]
ATL4G_ARATH4.003e-1540.66RING-H2 finger protein ATL4G OS=Arabidopsis thalia... [more]
ATL1A_ARATH4.003e-1542.35RING-H2 finger protein ATL1A OS=Arabidopsis thalia... [more]
ATL3G_ARATH5.228e-1545.56RING-H2 finger protein ATL3G OS=Arabidopsis thalia... [more]
ATL5N_ARATH1.521e-1447.30Putative RING-H2 finger protein ATL5N OS=Arabidops... [more]
ATL4H_ARATH3.389e-1453.45Putative RING-H2 finger protein ATL4H OS=Arabidops... [more]
ATL4E_ARATH3.389e-1438.04RING-H2 finger protein ATL4E OS=Arabidopsis thalia... [more]
ATL3E_ARATH3.389e-1449.18Putative RING-H2 finger protein ATL3E OS=Arabidops... [more]
ATL2K_ARATH3.389e-1441.38RING-H2 finger protein ATL2K OS=Arabidopsis thalia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402A10EF CTVClemen1 Citrus clementina cDNA clone C31402A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875266 ID=FC875266|Name=FC875266|organism=Citrus clementina|type=EST|length=673bp
GATTTTCACAAATCTCACCGCCTCCTTGCTCTCTCTCTCTCTCTTTCCAA
CTCTCTCTCCACATCTCATGCAATAATGGGGTCACGACTCTTACCCTACT
CCGCGAAACATGGGACCAATCCCCTTTCTCTCCTCCTCCTCATGCTCCTC
GTCGCCAACGCGCTCCCCCTCCCGCTCGCCCAGCGCAGCCCCGAGTCCCC
GGGCTCCGTCGACCCCTACTCCAACATGAAATTCAGCCCCTCACTCGCCA
TAATAATCGTCGTGTTGATTTCGGCTCTCTTCTTCATGGGCTTCTTCTCC
ATCTACATCCGCCACTGCTCCGACTCCAGCAACTCCGTCATCCGCCCCTC
CGGCGCCGGAGGCAACCGCTCCAGGCGCGGCGCCGCCCGTGGCCTCGACC
GCGAGGTCATCGACACTTTCCCGACCTTCGTCTACTCCGACGTCAAGACG
CTGAAGGTCGGCAAAGGCGCGCTCGAGTGCGCCGTCTGCCTGAACGAGTT
CGAGGACGACGAAACGCTGCGTTTGATCCCGAAATGCGACCACGTCTTCC
ACCCCGAGTGTATCGACGCCTGGCTTGAATCGCACACCACGTGTCCCGTT
TGCCGCTCGAATTTGGCCTCTGAACCCGGTGAGACAACTCCTCAACCCAG
TGAGCTGGGCTCATCCGAGGTGG
back to top