FC875266

Overview
NameFC875266
Unique NameFC875266
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length673
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875266_ssr29 microsatellite FC875266_ssr29:29..44. BLAST: Citrus ESTs to Prunus persica proteins V1
FC875266_ssr130 microsatellite FC875266_ssr130:130..141. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10192 contig Ccv1_Contig10192:1..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1P_ARATH (RING-H2 finger protein ATL1P OS=Arabidopsis thaliana GN=ATL1P PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.391e-13
Identity = 27/51 (52.94%), Postives = 38/51 (74.51%), Query Frame = 1
Query:  463 KGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNL 615
            K  LEC++CL+E    +  RL+PKC+H FH ECID W +SH+TCP+CR+ +
Sbjct:  122 KDGLECSICLSELVKGDKARLLPKCNHSFHVECIDMWFQSHSTCPICRNTV 172          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1M_ARATH (RING-H2 finger protein ATL1M OS=Arabidopsis thaliana GN=ATL1M PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.391e-13
Identity = 27/53 (50.94%), Postives = 40/53 (75.47%), Query Frame = 1
Query:  463 KGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLAS 621
            K  LECAVCL++  D +  R++P+C+H FH +CID W +SH+TCP+CR+ + S
Sbjct:  115 KDGLECAVCLSDLVDGDKARVLPRCNHGFHVDCIDMWFQSHSTCPLCRNTVGS 167          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1E_ARATH (RING-H2 finger protein ATL1E OS=Arabidopsis thaliana GN=ATL1E PE=2 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 8.347e-13
Identity = 29/73 (39.73%), Postives = 48/73 (65.75%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSN 612
            LD+  I+++      + + L  G   + C +CL+E+   ET+R +P+CDH FH +CID WL+ H++CPVCR++
Sbjct:  226 LDQSTIESYKKVELGESRRLP-GTNGIICPICLSEYASKETVRCMPECDHCFHVQCIDEWLKIHSSCPVCRNS 297          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL3C_ARATH (RING-H2 finger protein ATL3C OS=Arabidopsis thaliana GN=ATL3C PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.090e-12
Identity = 37/92 (40.22%), Postives = 53/92 (57.61%), Query Frame = 1
Query:  394 LDREVIDTFPTFVY-SDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQPSELGSS 666
            L ++ +   P  +Y S +  +K    A EC +CL +FED E +R++PKC+H FH  CID WL S ++CP CR +L  E      QPS +  S
Sbjct:   89 LKKQALKQIPVGLYGSGIIDMK----ATECLICLGDFEDGEKVRVLPKCNHGFHVRCIDTWLLSRSSCPTCRQSLLLE------QPSPMAVS 170          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5A_ARATH (RING-H2 finger protein ATL5A OS=Arabidopsis thaliana GN=ATL5A PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.424e-12
Identity = 33/74 (44.59%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNL 615
            L +  +  FP   Y   +   V   A ECA+CL EF D E +R++P C+H FH  CID WL SH++CP CR +L
Sbjct:   80 LKKRELKKFPVAEYGSGE---VKIAATECAICLGEFADGERVRVLPPCNHSFHMSCIDTWLVSHSSCPNCRHSL 150          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL2I_ARATH (RING-H2 finger protein ATL2I OS=Arabidopsis thaliana GN=ATL2I PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.860e-12
Identity = 34/98 (34.69%), Postives = 56/98 (57.14%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSN-----LASEPGETTPQPSELGSSEV 672
            LD + I ++P  +YS+ K       A  CA+CL +++    LR +P C+H+FH +CID WL  + TCPVCR++     L++   E  P  S + ++ +
Sbjct:  122 LDEDTIQSYPKILYSEAKGPTT---ASCCAICLGDYKGKHLLRQLPDCNHLFHLKCIDTWLRLNPTCPVCRTSPLPTPLSTPLAEVVPLASSVAATRM 216          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1K_ARATH (RING-H2 finger protein ATL1K OS=Arabidopsis thaliana GN=ATL1K PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.429e-12
Identity = 37/98 (37.76%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLA----------SEPGETTPQPSEL 657
            + ++ +  FP   YS    L  G    EC +CL++F   E LRL+PKC+H FH  CID WL+ H TCP CR+ L           S+    T +P+E+
Sbjct:  109 IKKKALRMFPVVSYSPEMNLP-GLDE-ECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQQHLTCPKCRNCLVETCQKILGDFSQADSVTAEPTEI 204          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL2M_ARATH (RING-H2 finger protein ATL2M OS=Arabidopsis thaliana GN=ATL2M PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.143e-12
Identity = 33/86 (38.37%), Postives = 53/86 (61.63%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKV-----GKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGET 636
            LD+ VI+++P F +S   +        G G   C++CL E+++ E LR++P+C H FH  C+DAWL+ + +CPVCR++    P  T
Sbjct:  105 LDQAVINSYPKFHFSKDTSAASSDGFGGGGDTTCSICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTST 190          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1J_ARATH (RING-H2 finger protein ATL1J OS=Arabidopsis thaliana GN=ATL1J PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.143e-12
Identity = 33/71 (46.48%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCR 606
            + ++ +  FP   YS    L  G G  EC +CL++F   E LRL+PKC+H FH  CID WL+ H TCP CR
Sbjct:  109 IKKKALRMFPVVSYSREMNLP-GIGE-ECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPKCR 177          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1I_ARATH (RING-H2 finger protein ATL1I OS=Arabidopsis thaliana GN=ATL1I PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.411e-12
Identity = 31/71 (43.66%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCR 606
            ++++ +  FP   YS    L  G G  EC +CL++F   E +R++PKC H FH  CID WL+ H TCP CR
Sbjct:  110 INKKALRMFPVVSYSPEMNLP-GLGE-ECVICLSDFVSGEQIRMLPKCHHGFHVRCIDKWLQQHLTCPKCR 178          
The following BLAST results are available for this feature:
BLAST of FC875266 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
ATL1P_ARATH6.391e-1352.94RING-H2 finger protein ATL1P OS=Arabidopsis thalia... [more]
ATL1M_ARATH6.391e-1350.94RING-H2 finger protein ATL1M OS=Arabidopsis thalia... [more]
ATL1E_ARATH8.347e-1339.73RING-H2 finger protein ATL1E OS=Arabidopsis thalia... [more]
ATL3C_ARATH1.090e-1240.22RING-H2 finger protein ATL3C OS=Arabidopsis thalia... [more]
ATL5A_ARATH1.424e-1244.59RING-H2 finger protein ATL5A OS=Arabidopsis thalia... [more]
ATL2I_ARATH1.860e-1234.69RING-H2 finger protein ATL2I OS=Arabidopsis thalia... [more]
ATL1K_ARATH2.429e-1237.76RING-H2 finger protein ATL1K OS=Arabidopsis thalia... [more]
ATL2M_ARATH4.143e-1238.37RING-H2 finger protein ATL2M OS=Arabidopsis thalia... [more]
ATL1J_ARATH4.143e-1246.48RING-H2 finger protein ATL1J OS=Arabidopsis thalia... [more]
ATL1I_ARATH5.411e-1243.66RING-H2 finger protein ATL1I OS=Arabidopsis thalia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402A10EF CTVClemen1 Citrus clementina cDNA clone C31402A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875266 ID=FC875266|Name=FC875266|organism=Citrus clementina|type=EST|length=673bp
GATTTTCACAAATCTCACCGCCTCCTTGCTCTCTCTCTCTCTCTTTCCAA
CTCTCTCTCCACATCTCATGCAATAATGGGGTCACGACTCTTACCCTACT
CCGCGAAACATGGGACCAATCCCCTTTCTCTCCTCCTCCTCATGCTCCTC
GTCGCCAACGCGCTCCCCCTCCCGCTCGCCCAGCGCAGCCCCGAGTCCCC
GGGCTCCGTCGACCCCTACTCCAACATGAAATTCAGCCCCTCACTCGCCA
TAATAATCGTCGTGTTGATTTCGGCTCTCTTCTTCATGGGCTTCTTCTCC
ATCTACATCCGCCACTGCTCCGACTCCAGCAACTCCGTCATCCGCCCCTC
CGGCGCCGGAGGCAACCGCTCCAGGCGCGGCGCCGCCCGTGGCCTCGACC
GCGAGGTCATCGACACTTTCCCGACCTTCGTCTACTCCGACGTCAAGACG
CTGAAGGTCGGCAAAGGCGCGCTCGAGTGCGCCGTCTGCCTGAACGAGTT
CGAGGACGACGAAACGCTGCGTTTGATCCCGAAATGCGACCACGTCTTCC
ACCCCGAGTGTATCGACGCCTGGCTTGAATCGCACACCACGTGTCCCGTT
TGCCGCTCGAATTTGGCCTCTGAACCCGGTGAGACAACTCCTCAACCCAG
TGAGCTGGGCTCATCCGAGGTGG
back to top