FC875266

Overview
NameFC875266
Unique NameFC875266
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length673
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875266_ssr29 microsatellite FC875266_ssr29:29..44. BLAST: Citrus ESTs to Prunus persica proteins V1
FC875266_ssr130 microsatellite FC875266_ssr130:130..141. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10192 contig Ccv1_Contig10192:1..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: R126B_XENLA (RING finger protein 126-B OS=Xenopus laevis GN=rnf126-B PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.813e-11
Identity = 34/82 (41.46%), Postives = 48/82 (58.54%), Query Frame = 1
Query:  397 DREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTP 642
            D + I   PT   ++     VG G LEC VC  ++   E++R +P C+H+FH +CI  WLE H TCPVCR +L+ +   T P
Sbjct:  205 DTDKIQALPTIQITEEH---VGFG-LECPVCKEDYTVGESVRQLP-CNHLFHNDCIIPWLEQHDTCPVCRKSLSGQNTATNP 281          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4L_ARATH (RING-H2 finger protein ATL4L OS=Arabidopsis thaliana GN=ATL4L PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.813e-11
Identity = 24/49 (48.98%), Postives = 33/49 (67.35%), Query Frame = 1
Query:  460 GKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCR 606
            G  + ECA+C+ EF + E +R++P C H FH  CID WL S ++CP CR
Sbjct:  107 GDSSTECAICITEFSEGEEIRILPLCSHAFHVACIDKWLTSRSSCPSCR 155          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1B_ARATH (RING-H2 finger protein ATL1B OS=Arabidopsis thaliana GN=ATL1B PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.813e-11
Identity = 30/74 (40.54%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNL 615
            L ++V+ + P   +S        +   ECA+CL EF   + LR++P+C H FH  CID WL SH++CP CR  L
Sbjct:   85 LKKKVLQSLPKLTFSPESP--ESEKFAECAICLAEFSAGDELRVLPQCGHGFHVACIDTWLGSHSSCPSCRQIL 156          
The following BLAST results are available for this feature:
BLAST of FC875266 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
R126B_XENLA7.813e-1141.46RING finger protein 126-B OS=Xenopus laevis GN=rnf... [more]
ATL4L_ARATH7.813e-1148.98RING-H2 finger protein ATL4L OS=Arabidopsis thalia... [more]
ATL1B_ARATH7.813e-1140.54RING-H2 finger protein ATL1B OS=Arabidopsis thalia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402A10EF CTVClemen1 Citrus clementina cDNA clone C31402A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875266 ID=FC875266|Name=FC875266|organism=Citrus clementina|type=EST|length=673bp
GATTTTCACAAATCTCACCGCCTCCTTGCTCTCTCTCTCTCTCTTTCCAA
CTCTCTCTCCACATCTCATGCAATAATGGGGTCACGACTCTTACCCTACT
CCGCGAAACATGGGACCAATCCCCTTTCTCTCCTCCTCCTCATGCTCCTC
GTCGCCAACGCGCTCCCCCTCCCGCTCGCCCAGCGCAGCCCCGAGTCCCC
GGGCTCCGTCGACCCCTACTCCAACATGAAATTCAGCCCCTCACTCGCCA
TAATAATCGTCGTGTTGATTTCGGCTCTCTTCTTCATGGGCTTCTTCTCC
ATCTACATCCGCCACTGCTCCGACTCCAGCAACTCCGTCATCCGCCCCTC
CGGCGCCGGAGGCAACCGCTCCAGGCGCGGCGCCGCCCGTGGCCTCGACC
GCGAGGTCATCGACACTTTCCCGACCTTCGTCTACTCCGACGTCAAGACG
CTGAAGGTCGGCAAAGGCGCGCTCGAGTGCGCCGTCTGCCTGAACGAGTT
CGAGGACGACGAAACGCTGCGTTTGATCCCGAAATGCGACCACGTCTTCC
ACCCCGAGTGTATCGACGCCTGGCTTGAATCGCACACCACGTGTCCCGTT
TGCCGCTCGAATTTGGCCTCTGAACCCGGTGAGACAACTCCTCAACCCAG
TGAGCTGGGCTCATCCGAGGTGG
back to top