FC875468

Overview
NameFC875468
Unique NameFC875468
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14327 contig Ccv1_Contig14327:257..966. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC1_BOVIN (Histone deacetylase 1 OS=Bos taurus GN=HDAC1 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.202e-14
Identity = 58/237 (24.47%), Postives = 110/237 (46.41%), Query Frame = 2
Query:    8 NKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFD--SRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPG-HHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            N L   G+ R+  +    +A  + +   H+++++  +++I        S++ +  +      + +G  E   L+ G    VA  V   +  +  A+    G HHA+  EA GFC  N++ +A   LL         ++L +D D+HHG+  ++ F+   RV+  +V  H++G ++P   D     IG G G  Y +N P  +G   D  Y A++  ++    + F P  +++  G D
Sbjct:   40 NLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGG--SVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYH-----QRVLYIDIDIHHGDGVEEAFYTTDRVM--TVSFHKYGEYFPGTGD--LRDIGAGKGKYYAVNYPLRDG-IDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSD 264          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDA19_MAIZE (Probable histone deacetylase 19 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.202e-14
Identity = 60/232 (25.86%), Postives = 109/232 (46.98%), Query Frame = 2
Query:   26 GIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLN---SIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPG-HHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            G+  +  V     A+++ L   H E ++N +++++ +     + R+  + N      + +G        AG+ +  A +   G      AI    G HHA+  EA GFC  N++ +A   LL         ++L VD D+HHG+  ++ F+   RV+  +V  H+FG ++P   D     IG   G  Y++NVP ++G   D  Y +++  I+    + F P  +++  G D
Sbjct:   60 GLLNQMQVYRPNPARERELCRFHAEEYINFLRSVTPET-QQDQIRLLKRFNVGEECPVLDGLYSFCQTYAGASVGGAVKFNHGH---DIAINWSGGLHHAKKCEASGFCYVNDIVLAILELLKHH-----ERVLYVDIDIHHGDGVEEAFYTTDRVM--TVSFHKFGDYFPGTGD--IRDIGHSKGKYYSLNVPLDDG-IDDESYQSLFKPIMGKVMEVFRPGAVVLQCGAD 277          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC1_DROME (Histone deacetylase Rpd3 OS=Drosophila melanogaster GN=Rpd3 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 3.755e-14
Identity = 63/238 (26.47%), Postives = 109/238 (45.80%), Query Frame = 2
Query:    8 NKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLN---SIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPG-HHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            N L   G+ R+  +    +A    +   H++ +V  +++I      S  ++   + N      + +G  E   L+AG    VA  V   +  S   I    G HHA+  EA GFC  N++ +    LL         ++L +D DVHHG+  ++ F+   RV+  +V  H++G ++P   D     IG G G  Y +N+P  +G   DA Y +++  I+    + F P  +++  G D
Sbjct:   38 NLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNM-SEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGG--SVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYH-----QRVLYIDIDVHHGDGVEEAFYTTDRVM--TVSFHKYGEYFPGTGD--LRDIGAGKGKYYAVNIPLRDGMDDDA-YESIFVPIISKVMETFQPAAVVLQCGAD 262          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDA1B_XENLA (Probable histone deacetylase 1-B OS=Xenopus laevis GN=hdac1-B PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.755e-14
Identity = 57/237 (24.05%), Postives = 110/237 (46.41%), Query Frame = 2
Query:    8 NKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFD--SRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPG-HHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            N L   G+ R+  +    +A  + +   H+++++  +++I        S++ +  +      + +G  E   L+ G    VA  V   +  +  ++    G HHA+  EA GFC  N++ +A   LL         +++ +D D+HHG+  ++ F+   RV+  SV  H++G ++P   D     IG G G  Y +N P  +G   D  Y A++  ++    + F P  +++  G D
Sbjct:   40 NLLLNYGLYRKMEIYRPHKASAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGG--SVASAVKLNKQQTDISVNWSGGLHHAKKSEASGFCYVNDIVLAILELLKYH-----QRVVYIDIDIHHGDGVEEAFYTTDRVM--SVSFHKYGEYFPGTGD--LRDIGAGKGKYYAVNYPLRDG-IDDESYEAIFKPVMTKVMEMFQPSAVVLQCGAD 264          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC8_BOVIN (Histone deacetylase 8 OS=Bos taurus GN=HDAC8 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.905e-14
Identity = 64/235 (27.23%), Postives = 109/235 (46.38%), Query Frame = 2
Query:   14 LQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLN-SIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPG--HHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            ++A  + ++  ++  K A  + + S HT+ ++  ++ +S    D   D I   L       EG  + A    G+ I  A+ + +G    A   +   G  HHA+ DEA GFC Y N AV     L  +     ++IL VD D+HHG+  +  F    +V+  S+H+   G F+P   D   + +G G G  Y++NVP ++    D  Y  + + +L      F P  +++  G D
Sbjct:   45 IEAYALHKQMRIVKPKVASMEEMASFHTDAYLQHLQKVSEDGDDDHPDSIEYGLGYDCPATEGIFDYAAAVGGATITAAQCLIDGMCKVA---INWSGGWHHAKKDEASGFC-YLNDAVLGILRLRRK----FDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPG-FFPGTGD--VSDVGLGKGRYYSVNVPIQD-CIQDERYYHICESVLKEVYIAFNPKAVVLQLGAD 267          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDA1A_XENLA (Probable histone deacetylase 1-A OS=Xenopus laevis GN=hdac1-A PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.864e-13
Identity = 56/237 (23.63%), Postives = 111/237 (46.84%), Query Frame = 2
Query:    8 NKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFD--SRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPG-HHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            N L   G+ R+  +    +A  +++   H+++++  +++I        S++ +  +      + +G  E   L+AG    VA  V   +  +  ++    G HHA+  EA GFC  N++ +A   LL         +++ +D D+HHG+  ++ F+   RV+  +V  H++G ++P   D     IG G G  Y +N    +G   D  Y A++  ++    + F P  +++  G D
Sbjct:   40 NLLLNYGLYRKMEIFRPHKASAEDMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGG--SVASAVKLNKQQTDISVNWSGGLHHAKKSEASGFCYVNDIVLAILELLKYH-----QRVVYIDIDIHHGDGVEEAFYTTDRVM--TVSFHKYGEYFPGTGD--LRDIGAGKGKYYAVNYALRDG-IDDESYEAIFKPVMSKVMEMFQPSAVVLQCGAD 264          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: ACUC_BACSU (Acetoin utilization protein acuC OS=Bacillus subtilis GN=acuC PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.864e-13
Identity = 60/225 (26.67%), Postives = 102/225 (45.33%), Query Frame = 2
Query:   47 VLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDR---IASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTF-YPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            ++  + A ++ L  VHT++++  +K   + +  +       + ++   ++   G  EAA L  G  +  A+ V  G+   A A +    HH     A GFC+YN+ AVA  ++  +       ++L +D D HHG+  Q  F+ +P V   S+  HE G + +P    G     G G G GY+ N+P +     D  +L  +          F PD+II   G D
Sbjct:   46 IVTPRLASEEELSLVHTDDYIQAVKLAGAGKLPAEEGESYGLGTEDTPVFA--GMHEAASLLVGGTLTAADWVMSGQALHA-ANLGGGLHHGFRGRASGFCIYNDSAVAIQYIQKKYSA----RVLYIDTDAHHGDGVQFTFYDNPDVCTLSI--HETGRYLFPGT--GQIQEKGSGKGYGYSFNIPLD-AFTEDDSFLEAYRTAASEVAAYFEPDVIISQNGAD 258          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC2_MOUSE (Histone deacetylase 2 OS=Mus musculus GN=Hdac2 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.423e-13
Identity = 56/238 (23.53%), Postives = 109/238 (45.80%), Query Frame = 2
Query:    8 NKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFD--SRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPG--HHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            N L   G+ R+  +    +A  + +   H++ ++  +++I        S++ +  +      + +G  E   L+ G  +  A ++   + + A   V   G  HHA+  EA GFC  N++ +A   LL         ++L +D D+HHG+  ++ F+   RV+  +V  H++G ++P   D     IG G G  Y +N P  +G   D  Y  ++  I+    + + P  +++  G D
Sbjct:   41 NLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMA---VNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYH-----QRVLYIDIDIHHGDGVEEAFYTTDRVM--TVSFHKYGEYFPGTGD--LRDIGAGKGKYYAVNFPMRDG-IDDESYGQIFKPIISKVMEMYQPSAVVLQCGAD 265          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC2_HUMAN (Histone deacetylase 2 OS=Homo sapiens GN=HDAC2 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 5.423e-13
Identity = 56/238 (23.53%), Postives = 109/238 (45.80%), Query Frame = 2
Query:    8 NKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFD--SRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPG--HHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            N L   G+ R+  +    +A  + +   H++ ++  +++I        S++ +  +      + +G  E   L+ G  +  A ++   + + A   V   G  HHA+  EA GFC  N++ +A   LL         ++L +D D+HHG+  ++ F+   RV+  +V  H++G ++P   D     IG G G  Y +N P  +G   D  Y  ++  I+    + + P  +++  G D
Sbjct:   41 NLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMA---VNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYH-----QRVLYIDIDIHHGDGVEEAFYTTDRVM--TVSFHKYGEYFPGTGD--LRDIGAGKGKYYAVNFPMRDG-IDDESYGQIFKPIISKVMEMYQPSAVVLQCGAD 265          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC3_XENTR (Histone deacetylase 3 OS=Xenopus tropicalis GN=hdac3 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.208e-12
Identity = 55/238 (23.11%), Postives = 106/238 (44.54%), Query Frame = 2
Query:   26 GIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLNSIYLNE------GSSEAAYLAAGSVIEVA----ERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            G+ ++ +V    +A   ++   H+E++++ ++ +S              LN+  + +      G  E      G+ ++ A     ++ +  +N A  +     HHA+  EA GFC  N++ +    LL   P     ++L VD D+HHG+  Q+ F+   RV+  S H++    F+P   D +   +G   G  Y +NVP  +G   D  Y  ++  ++      + P  I++  G D
Sbjct:   40 GLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPNNMQG----FTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGL-----HHAKKFEASGFCYVNDIVIGILELLKYHP-----RVLYVDIDIHHGDGVQEAFYLTDRVMTVSFHKYG-NYFFPGTGDMY--EVGAESGRYYCLNVPLRDG-IDDQSYRHLFQPVIKQVIDFYQPTCIVLQCGAD 259          
The following BLAST results are available for this feature:
BLAST of FC875468 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
HDAC1_BOVIN2.202e-1424.47Histone deacetylase 1 OS=Bos taurus GN=HDAC1 PE=2 ... [more]
HDA19_MAIZE2.202e-1425.86Probable histone deacetylase 19 OS=Zea mays PE=2 S... [more]
HDAC1_DROME3.755e-1426.47Histone deacetylase Rpd3 OS=Drosophila melanogaste... [more]
HDA1B_XENLA3.755e-1424.05Probable histone deacetylase 1-B OS=Xenopus laevis... [more]
HDAC8_BOVIN4.905e-1427.23Histone deacetylase 8 OS=Bos taurus GN=HDAC8 PE=2 ... [more]
HDA1A_XENLA1.864e-1323.63Probable histone deacetylase 1-A OS=Xenopus laevis... [more]
ACUC_BACSU1.864e-1326.67Acetoin utilization protein acuC OS=Bacillus subti... [more]
HDAC2_MOUSE5.423e-1323.53Histone deacetylase 2 OS=Mus musculus GN=Hdac2 PE=... [more]
HDAC2_HUMAN5.423e-1323.53Histone deacetylase 2 OS=Homo sapiens GN=HDAC2 PE=... [more]
HDAC3_XENTR1.208e-1223.11Histone deacetylase 3 OS=Xenopus tropicalis GN=hda... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404C07EF CTVClemen1 Citrus clementina cDNA clone C31404C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875468 ID=FC875468|Name=FC875468|organism=Citrus clementina|type=EST|length=710bp
GATTTGGAACAAGCTCCAAGCCGCTGGCATTCCTCGACGGTGTGTCGTTT
TAAATTCCAAAGAAGCGAAAGACAAAAATCTACTGTCTGTGCACACGGAA
AATCATGTTAATTTGATTAAGAATATAAGCTCAAAGCAGTTTGATTCCCG
AAGAGATAGGATTGCGTCAAAATTAAATTCAATTTACTTAAATGAAGGAT
CATCGGAGGCTGCTTATCTTGCTGCCGGTTCAGTTATAGAGGTCGCCGAG
AGAGTTGCCGAAGGGGAGTTGAATTCTGCTTTTGCTATTGTGAGACCTCC
TGGTCATCATGCTGAACCAGATGAAGCTATGGGATTTTGTCTATACAACA
ATGTGGCTGTTGCTGCAAGTTTCCTATTAAATGAAAGACCAGAACTGGGA
ATCAATAAAATTTTGATTGTTGATTGGGATGTTCACCATGGTAACAGTAC
TCAAAAGATGTTCTGGAAGGATCCCCGTGTCCTATTCTTCTCTGTTCATA
GGCATGAGTTTGGAACTTTTTATCCTGCCAATGATGATGGTTTCTATACT
ATGATTGGTGAAGGACCTGGTTTGGGATACAACATTAATGTCCCTTGGGA
GAATGGGAGGTGCGGTGATGCAGACTATCTGGCAGTTTGGGACCATATTT
TACTTCCTGGTTGCAAGGATTTTGGACCTGACATAATCATAATATCTGCT
GGATTCGATG
back to top