FC875468

Overview
NameFC875468
Unique NameFC875468
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14327 contig Ccv1_Contig14327:257..966. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDA9_ARATH (Histone deacetylase 9 OS=Arabidopsis thaliana GN=HDA9 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.744e-11
Identity = 62/237 (26.16%), Postives = 110/237 (46.41%), Query Frame = 2
Query:   20 AAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIA--SKLNSIYLNEGSSEAAYLAAGSVIEVAERV----AEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFG-TFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            A G+  +  V    +A    +   H+ ++V  ++ I+ +  +   + +A  +      + E   E   L AG  I+ A R+     +  +N A  +     HHA+  +A GFC  N++ +    LL   P     ++L +D DVHHG+  ++ F+   RV+  +V  H+FG  F+P   D     IGE  G  Y INVP ++G   D+ +  ++  I+    + + P  I++  G D
Sbjct:   40 AYGLHSKMEVYRPHKAYPIEMAQFHSPDYVEFLQRINPENQNLFPNEMARYNLGEDCPVFEDLFEFCQLYAGGTIDAARRLNNKLCDIAINWAGGL-----HHAKKCDASGFCYINDLVLGILELLKHHP-----RVLYIDIDVHHGDGVEEAFYFTDRVM--TVSFHKFGDKFFPGTGD--VKEIGEREGKFYAINVPLKDG-IDDSSFNRLFRTIISKVVEIYQPGAIVLQCGAD 261          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDA6_ARATH (Histone deacetylase 6 OS=Arabidopsis thaliana GN=HDA6 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.886e-11
Identity = 39/135 (28.89%), Postives = 69/135 (51.11%), Query Frame = 2
Query:  305 HHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            HHA+  EA GFC  N++ +    LL         ++L +D DVHHG+  ++ F+   RV+  +V  H+FG F+P    G    +G   G  Y +NVP  +G   D  + +++  ++    + + P+ +++  G D
Sbjct:  152 HHAKKSEASGFCYVNDIVLGILELLKM-----FKRVLYIDIDVHHGDGVEEAFYTTDRVM--TVSFHKFGDFFPGT--GHIRDVGAEKGKYYALNVPLNDG-MDDESFRSLFRPLIQKVMEVYQPEAVVLQCGAD 276          
The following BLAST results are available for this feature:
BLAST of FC875468 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
HDA9_ARATH1.744e-1126.16Histone deacetylase 9 OS=Arabidopsis thaliana GN=H... [more]
HDA6_ARATH3.886e-1128.89Histone deacetylase 6 OS=Arabidopsis thaliana GN=H... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404C07EF CTVClemen1 Citrus clementina cDNA clone C31404C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875468 ID=FC875468|Name=FC875468|organism=Citrus clementina|type=EST|length=710bp
GATTTGGAACAAGCTCCAAGCCGCTGGCATTCCTCGACGGTGTGTCGTTT
TAAATTCCAAAGAAGCGAAAGACAAAAATCTACTGTCTGTGCACACGGAA
AATCATGTTAATTTGATTAAGAATATAAGCTCAAAGCAGTTTGATTCCCG
AAGAGATAGGATTGCGTCAAAATTAAATTCAATTTACTTAAATGAAGGAT
CATCGGAGGCTGCTTATCTTGCTGCCGGTTCAGTTATAGAGGTCGCCGAG
AGAGTTGCCGAAGGGGAGTTGAATTCTGCTTTTGCTATTGTGAGACCTCC
TGGTCATCATGCTGAACCAGATGAAGCTATGGGATTTTGTCTATACAACA
ATGTGGCTGTTGCTGCAAGTTTCCTATTAAATGAAAGACCAGAACTGGGA
ATCAATAAAATTTTGATTGTTGATTGGGATGTTCACCATGGTAACAGTAC
TCAAAAGATGTTCTGGAAGGATCCCCGTGTCCTATTCTTCTCTGTTCATA
GGCATGAGTTTGGAACTTTTTATCCTGCCAATGATGATGGTTTCTATACT
ATGATTGGTGAAGGACCTGGTTTGGGATACAACATTAATGTCCCTTGGGA
GAATGGGAGGTGCGGTGATGCAGACTATCTGGCAGTTTGGGACCATATTT
TACTTCCTGGTTGCAAGGATTTTGGACCTGACATAATCATAATATCTGCT
GGATTCGATG
back to top