FC875476

Overview
NameFC875476
Unique NameFC875476
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length711
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11876 contig Ccv1_Contig11876:356..1067. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CPR1_ARATH (Probable cysteine proteinase At3g19400 OS=Arabidopsis thaliana GN=At3g19400 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.496e-42
Identity = 100/225 (44.44%), Postives = 136/225 (60.44%), Query Frame = 2
Query:   53 GVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAP--ILPTND-LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSK--IAASVANFSVVSLDEDQIAANLVKNGPLAVAINA--VYMQTYIGGVSCPYICSRRLDHGVVLVGYGS 706
            G+T+F+DLT  EFR  YL  R+K+   KD+ +    +    D LP + DWR  GAV  VKDQG+CGSCW+FS  GA+EG N + TG+L+SLSEQ+LVDCD        G  ++GC+GG+MN AFE+ +K GG+  ++DYPY   D G  C  DK+      ++  +  V  D+++     V + P++VAI A     Q Y  GV     C   LDHGVV+VGYGS
Sbjct:   89 GLTRFADLTNEEFRAIYL--RKKMERTKDSVKTERYLYKEGDVLPDEVDWRANGAVVSVKDQGNCGSCWAFSAVGAVEGINQITTGELISLSEQELVDCDR-------GFVNAGCDGGIMNYAFEFIMKNGGIETDQDYPYNANDLG-LCNADKNNNTRVVTIDGYEDVPRDDEKSLKKAVAHQPVSVAIEASSQAFQLYKSGVMTG-TCGISLDHGVVVVGYGS 302          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CPR1_DROME (Putative cysteine proteinase CG12163 OS=Drosophila melanogaster GN=CG12163 PE=2 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.239e-41
Identity = 95/227 (41.85%), Postives = 141/227 (62.11%), Query Frame = 2
Query:   41 SATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPT--NDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANF-SVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPY--ICSRR-LDHGVVLVGYG 703
            SA +G+T+F+D+T +E++    GL ++         A ++P    +LP +FDWR+K AV  VK+QGSCGSCW+FS TG +EG   + TG+L   SEQ+L+DCD         + DS CNGGLM++A++     GGL  E +YPY    + + C F+++     VA F  +   +E  +   L+ NGP+++ INA  MQ Y GGVS P+  +CS++ LDHGV++VGYG
Sbjct:  349 SAKYGITEFADMTSSEYKER-TGLWQRDEAKATGGSAAVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQELLDCD---------TTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKA--KKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYG 563          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: ORYA_ORYSJ (Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 2.759e-41
Identity = 94/221 (42.53%), Postives = 127/221 (57.47%), Query Frame = 2
Query:   53 GVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTND-LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINA--VYMQTYIGGVSCPYICSRRLDHGVVLVGYGS 706
            G+ +F+DLT  E+R TYLGLR K R  +      +   N+ LP   DWR KGAV  +KDQG CGSCW+FS   A+EG N + TG L+SLSEQ+LVDCD         S + GCNGGLM+ AF++ +  GG+  E+DYPY G D         +K+  ++ ++  V+ + +      V N P++VAI A     Q Y  G+     C   LDHGV  VGYG+
Sbjct:   88 GLNRFADLTNEEYRDTYLGLRNKPRRERKVSDRYLAADNEALPESVDWRTKGAVAEIKDQGGCGSCWAFSAIAAVEGINQIVTGDLISLSEQELVDCD--------TSYNEGCNGGLMDYAFDFIINNGGIDTEDDYPYKGKDERCDVNRKNAKV-VTIDSYEDVTPNSETSLQKAVANQPVSVAIEAGGRAFQLYSSGIFTGK-CGTALDHGVAAVGYGT 298          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: XCP1_ARATH (Xylem cysteine proteinase 1 OS=Arabidopsis thaliana GN=XCP1 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.707e-41
Identity = 101/241 (41.91%), Postives = 135/241 (56.02%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPIL--PTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKI-AASVANFSVVSLDEDQIAANLVKNGPLAVAINAV--YMQTYIGGVSCPYICSRRLDHGVVLVGYGSA 709
            NL    +R     S   G+ +F+DLT  EF+  YLGL +     K    A        DLP   DWR+KGAV PVKDQG CGSCW+FST  A+EG N + TG L SLSEQ+L+DCD         + +SGCNGGLM+ AF+Y +  GGL +E+DYPY   +    C+  K  +   +++ +  V  ++D+     + + P++VAI A     Q Y GGV     C   LDHGV  VGYGS+
Sbjct:   78 NLMHIDQRNNEINSYWLGLNEFADLTHEEFKGRYLGLAKPQFSRKRQPSANFRYRDITDLPKSVDWRKKGAVAPVKDQGQCGSCWAFSTVAAVEGINQITTGNLSSLSEQELIDCD--------TTFNSGCNGGLMDYAFQYIISTGGLHKEDDYPYLMEE--GICQEQKEDVERVTISGYEDVPENDDESLVKALAHQPVSVAIEASGRDFQFYKGGVFNGK-CGTDLDHGVAAVGYGSS 307          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CATF_MOUSE (Cathepsin F OS=Mus musculus GN=Ctsf PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.707e-41
Identity = 103/240 (42.92%), Postives = 140/240 (58.33%), Query Frame = 2
Query:    2 NLRRAARRQKLDP-SATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDL-PADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPY--ICSR-RLDHGVVLVGYGS 706
            N+ RA + Q LD  +A +G+T+FSDLT  EF   YL     L+       +P    NDL P ++DWR+KGAV  VK+QG CGSCW+FS TG +EG  FL  G L+SLSEQ+L+DCD           D  C GGL ++A+      GGL  E+DY Y G      C F        + +   +S +E++IAA L + GP++VAINA  MQ Y  G++ P+  +CS   +DH V+LVGYG+
Sbjct:  192 NMIRAQKIQALDRGTAQYGITKFSDLTEEEFHTIYLN--PLLQKESGRKMSPAKSINDLAPPEWDWRKKGAVTEVKNQGMCGSCWAFSVTGNVEGQWFLNRGTLLSLSEQELLDCD---------KVDKACLGGLPSNAYAAIKNLGGLETEDDYGYQG--HVQTCNFSAQMAKVYINDSVELSRNENKIAAWLAQKGPISVAINAFGMQFYRHGIAHPFRPLCSPWFIDHAVLLVGYGN 418          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 6.147e-41
Identity = 97/238 (40.76%), Postives = 136/238 (57.14%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTND-LPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINA--VYMQTYIGGVSCPYICSRRLDHGVVLVGYGS 706
            NLR      + + S   G+T+F+DLT  E+R  YLG + + +  +           D LP   DWR+KGAV  VKDQG CGSCW+FST GA+EG N + TG L++LSEQ+LVDCD         S + GCNGGLM+ AFE+ +K GG+  ++DYPY G D G   +  K+    ++ ++  V    ++     V + P+++AI A     Q Y  G+     C  +LDHGVV VGYG+
Sbjct:   79 NLRFVDEHNEKNLSYRLGLTRFADLTNDEYRSKYLGAKMEKKGERRTSLRYEARVGDELPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAVEGINQIVTGDLITLSEQELVDCD--------TSYNEGCNGGLMDYAFEFIIKNGGIDTDKDYPYKGVD-GTCDQIRKNAKVVTIDSYEDVPTYSEESLKKAVAHQPISIAIEAGGRAFQLYDSGI-FDGSCGTQLDHGVVAVGYGT 306          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSP_TRYCR (Cruzipain OS=Trypanosoma cruzi PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.049e-40
Identity = 102/240 (42.50%), Postives = 131/240 (54.58%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPI-LPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKA--GGLMREEDYPY-TGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVVLVGYGSA 709
            NL  A      +P AT GVT FSDLT  EFR  Y          ++  + P+ +     PA  DWR +GAV  VKDQG CGSCW+FS  G +E   FLA   L +LSEQ LV CD           DSGC+GGLMN+AFE+ ++   G +  E+ YPY +G      C      + A++     +  DE QIAA L  NGP+AVA++A    TY GGV    + S +LDHGV+LVGY  +
Sbjct:   65 NLFLARLHAAANPHATFGVTPFSDLTREEFRSRYHNGAAHFAAAQERARVPVKVEVVGAPAAVDWRARGAVTAVKDQGQCGSCWAFSAIGNVECQWFLAGHPLTNLSEQMLVSCD---------KTDSGCSGGLMNNAFEWIVQENNGAVYTEDSYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTSCV-SEQLDHGVLLVGYNDS 294          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSP7_DICDI (Cysteine proteinase 7 OS=Dictyostelium discoideum GN=cprG PE=1 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.049e-40
Identity = 100/227 (44.05%), Postives = 134/227 (59.03%), Query Frame = 2
Query:   53 GVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTN---DLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGK--LVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANF-SVVSLDEDQIAANLVKNGPLAVAINA--VYMQTYIGGV-SCPYICSRRLDHGVVLVGYGS 706
            G+  F+D++  E+R TYLG       P DA    +  ++   D  A  DWR +GAV P+K+QG CG CWSFSTTGA EGA +LA GK  LVSLSEQ L+DC            ++GC GGLM  AFEY +   G+  E  YPYT  D G  CKF+   +AA ++++ +V S  E  +AA  V  GP +VAI+A     Q Y+ G+ + P   S +LDHGV+ VG+G+
Sbjct:   73 GLNVFADISNEEYRATYLGT------PFDASSLEMTESDKIFDASAQVDWRTQGAVTPIKNQGQCGGCWSFSTTGATEGAQYLANGKKNLVSLSEQNLIDCSGSYG-------NNGCEGGLMTLAFEYIINNKGIDTESSYPYTAED-GKKCKFNPKNVAAQLSSYVNVTSGSESDLAAK-VTQGPTSVAIDASNQSFQLYVSGIYNEPACSSTQLDHGVLAVGFGT 284          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: XCP2_ARATH (Xylem cysteine proteinase 2 OS=Arabidopsis thaliana GN=XCP2 PE=1 SV=2)

HSP 1 Score: 166.392 bits (420), Expect = 1.369e-40
Identity = 101/241 (41.91%), Postives = 139/241 (57.68%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRRKL-RLPKDADQAPIL--PTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAV--YMQTYIGGVSCPYICSRRLDHGVVLVGYGSA 709
            NL+      K   S   G+ +F+DL+  EF++ YLGL+  + R  ++   A         +P   DWR+KGAV  VK+QGSCGSCW+FST  A+EG N + TG L +LSEQ+L+DCD         + ++GCNGGLM+ AFEY +K GGL +EEDYPY+  +     + D+S+      +  V + DE  +   L  + PL+VAI+A     Q Y GGV     C   LDHGV  VGYGS+
Sbjct:   78 NLKHIDETNKKGKSYWLGLNEFADLSHEEFKKMYLGLKTDIVRRDEERSYAEFAYRDVEAVPKSVDWRKKGAVAEVKNQGSCGSCWAFSTVAAVEGINKIVTGNLTTLSEQELIDCD--------TTYNNGCNGGLMDYAFEYIVKNGGLRKEEDYPYSMEEGTCEMQKDESETVTINGHQDVPTNDEKSLLKALA-HQPLSVAIDASGREFQFYSGGV-FDGRCGVDLDHGVAAVGYGSS 308          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CATL1_RAT (Cathepsin L1 OS=Rattus norvegicus GN=Ctsl1 PE=1 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 1.789e-40
Identity = 96/225 (42.67%), Postives = 127/225 (56.44%), Query Frame = 2
Query:   50 HGVTQ----FSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVY--MQTYIGGVSC-PYICSRRLDHGVVLVGYG 703
            HG T     F D+T  EFR+   G R +        Q P++    +P   DWREKG V PVK+QG CGSCW+FS +G LEG  FL TGKL+SLSEQ LVDC H+         + GCNGGLM+ AF+Y  + GGL  EE YPY   D   +CK+      A+   F  +   E  +   +   GP++VA++A +  +Q Y  G+   P   S+ LDHGV++VGYG
Sbjct:   71 HGFTMEMNAFGDMTNEEFRQIVNGYRHQKHKKGRLFQEPLML--QIPKTVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHD-------QGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKD--GSCKYRAEYAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKDLDHGVLVVGYG 284          
The following BLAST results are available for this feature:
BLAST of FC875476 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 163
Match NameE-valueIdentityDescription
CPR1_ARATH2.496e-4244.44Probable cysteine proteinase At3g19400 OS=Arabidop... [more]
CPR1_DROME1.239e-4141.85Putative cysteine proteinase CG12163 OS=Drosophila... [more]
ORYA_ORYSJ2.759e-4142.53Oryzain alpha chain OS=Oryza sativa subsp. japonic... [more]
XCP1_ARATH4.707e-4141.91Xylem cysteine proteinase 1 OS=Arabidopsis thalian... [more]
CATF_MOUSE4.707e-4142.92Cathepsin F OS=Mus musculus GN=Ctsf PE=2 SV=1[more]
RD21A_ARATH6.147e-4140.76Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]
CYSP_TRYCR1.049e-4042.50Cruzipain OS=Trypanosoma cruzi PE=1 SV=1[more]
CYSP7_DICDI1.049e-4044.05Cysteine proteinase 7 OS=Dictyostelium discoideum ... [more]
XCP2_ARATH1.369e-4041.91Xylem cysteine proteinase 2 OS=Arabidopsis thalian... [more]
CATL1_RAT1.789e-4042.67Cathepsin L1 OS=Rattus norvegicus GN=Ctsl1 PE=1 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D03EF CTVClemen1 Citrus clementina cDNA clone C31404D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875476 ID=FC875476|Name=FC875476|organism=Citrus clementina|type=EST|length=711bp
CAACTTGCGACGCGCCGCGCGTCGCCAGAAGCTCGACCCGAGCGCCACCC
ACGGCGTCACTCAGTTCTCCGACTTGACTCCGGCCGAGTTCCGCCGGACG
TACCTTGGCCTCAGGAGGAAGCTGAGGCTGCCTAAGGATGCGGATCAGGC
GCCGATCTTGCCTACGAATGATTTGCCGGCGGATTTTGATTGGAGAGAGA
AGGGCGCTGTAGGCCCTGTTAAAGATCAGGGTTCATGCGGATCATGCTGG
AGTTTCAGTACAACAGGGGCCTTGGAAGGTGCTAACTTCCTGGCAACTGG
AAAGCTTGTGAGCCTCAGTGAGCAACAGCTTGTGGATTGCGATCATGAGT
GTGATCCTGAGGAACCAGGTTCTTGTGATTCTGGATGCAATGGTGGGCTT
ATGAACAGTGCTTTTGAGTACACACTCAAGGCTGGTGGGCTTATGCGGGA
GGAAGACTATCCTTACACCGGCACTGATCGTGGCCACGCCTGCAAATTCG
ATAAGAGTAAGATTGCTGCCTCAGTGGCCAACTTCAGTGTTGTCTCCCTT
GATGAGGATCAAATTGCTGCCAATCTTGTGAAAAATGGTCCCCTTGCAGT
GGCCATCAATGCCGTGTACATGCAGACATACATTGGGGGAGTTTCCTGCC
CATACATATGCTCGAGGCGATTGGACCATGGAGTGGTGCTCGTGGGATAC
GGTTCAGCTGG
back to top