FC875476

Overview
NameFC875476
Unique NameFC875476
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length711
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11876 contig Ccv1_Contig11876:356..1067. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSP3_HOMAM (Digestive cysteine proteinase 3 OS=Homarus americanus GN=LCP3 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.385e-37
Identity = 96/221 (43.44%), Postives = 120/221 (54.30%), Query Frame = 2
Query:   56 VTQFSDLTPAEFRRTYLGLRRKLR-LPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVY--MQTYIGGVSCPYICSRR-LDHGVVLVGYGS 706
            + QF D+T  EF     G ++  R  PK    A   P   + AD DWR K  V PVKDQ  CGSCW+FS TGALEG +FL   +LVSLSEQQLVDC  +         + GC GG M SAF+Y    GG+  E  YPY   DR  +C+FD + I A       V   E+ +   +   GP++VAI+A +   Q Y  GV     CS   LDHGV+ VGYG+
Sbjct:   69 MNQFGDMTNEEFNAVMKGYKKGSRGEPKAVFTAEAGP---MAADVDWRTKALVTPVKDQEQCGSCWAFSATGALEGQHFLKNDELVSLSEQQLVDCSTDYG-------NDGCGGGWMTSAFDYIKDNGGIDTESSYPYEAEDR--SCRFDANSIGAICTGSVEVQHTEEALQEAVSGVGPISVAIDASHFSFQFYSSGVYYEQNCSPTFLDHGVLAVGYGT 277          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSP2_LEIPI (Cysteine proteinase 2 OS=Leishmania pifanoi GN=CYS2 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.385e-37
Identity = 100/243 (41.15%), Postives = 133/243 (54.73%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYL-GLRRKLRLPKDADQAPILPTNDL---PADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLK--AGGLMREEDYPYTGTDRGHACKFDKSK----IAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVVLVGY 700
            NL      Q  +P A  G+T+F DL+ AEF   YL G        + A Q       DL   P   DWREKGAV PVKDQG+CGSCW+FS  G +EG  +LA  +LVSLSEQQLV CD           + GC+GGLM  AF++ L+   G L  E+ YPY  +  G+  +   S     + A +    ++   E  +AA L KNGP+A+A++A    +Y  GV    I  ++L+HGV+LVGY
Sbjct:   65 NLELMREHQARNPHAQFGITKFFDLSEAEFAARYLNGAAYFAAAKRHAAQHYRKARADLSAVPDAVDWREKGAVTPVKDQGACGSCWAFSAVGNIEGQWYLAGHELVSLSEQQLVSCD---------DMNDGCDGGLMLQAFDWLLQNTNGHLHTEDSYPYV-SGNGYVPECSNSSEELVVGAQIDGHVLIGSSEKAMAAWLAKNGPIAIALDASSFMSYKSGVLTACI-GKQLNHGVLLVGY 296          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSEP_PHAVU (Vignain OS=Phaseolus vulgaris PE=2 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 7.033e-37
Identity = 98/243 (40.33%), Postives = 130/243 (53.50%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLR----RKLR-LPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDK-SKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINA--VYMQTYIGGVSCPYICSRRLDHGVVLVGYGS 706
            NL       K+D      + +F+D+T  EFR TY G +    R  R  P +           +P   DWR+KGAV  VKDQG CGSCW+FST  A+EG N + T KLV+LSEQ+LVDCD E         + GCNGGLM SAFE+  + GG+  E +YPY   +    C   K + +A S+     V  +++      V N P++VAI+A     Q Y  GV     CS  L+HGV +VGYG+
Sbjct:   66 NLMHVHNTNKMDKPYKLKLNKFADMTNHEFRSTYAGSKVNHPRMFRGTPHENGAFMYEKVVSVPPSVDWRKKGAVTDVKDQGQCGSCWAFSTVVAVEGINQIKTNKLVALSEQELVDCDKE--------ENQGCNGGLMESAFEFIKQKGGITTESNYPYKAQE--GTCDASKVNDLAVSIDGHENVPANDEDALLKAVANQPVSVAIDAGGSDFQFYSEGVFTG-DCSTDLNHGVAIVGYGT 297          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CATL_DROME (Cathepsin L OS=Drosophila melanogaster GN=Cp1 PE=1 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 7.033e-37
Identity = 96/228 (42.11%), Postives = 137/228 (60.09%), Query Frame = 2
Query:   56 VTQFSDLTPAEFRRTYLG----LRRKLRLPKDADQAP--ILPTN-DLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFS-VVSLDEDQIAANLVKNGPLAVAINAVY--MQTYIGGV-SCPYICSRRLDHGVVLVGYGS 706
            V +++DL   EFR+   G    L ++LR   ++ +    I P +  LP   DWR KGAV  VKDQG CGSCW+FS+TGALEG +F  +G LVSLSEQ LVDC  +         ++GCNGGLM++AF Y    GG+  E+ YPY   D   +C F+K  + A+   F+ +   DE ++A  +   GP++VAI+A +   Q Y  GV + P   ++ LDHGV++VG+G+
Sbjct:  108 VNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPAHVTLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVSLSEQNLVDCSTKYG-------NNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAID--DSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFYSEGVYNEPQCDAQNLDHGVLVVGFGT 326          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSEP_RICCO (Vignain OS=Ricinus communis GN=CYSEP PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 9.186e-37
Identity = 97/243 (39.92%), Postives = 127/243 (52.26%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRRKLRL-----PKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKI-AASVANFSVVSLDEDQIAANLVKNGPLAVAINA--VYMQTYIGGVSCPYICSRRLDHGVVLVGYGS 706
            N        K+D      + +F+D+T  EFR TY G + K        P+          + +PA  DWR+KGAV  VKDQG CGSCW+FST  A+EG N + T KLVSLSEQ+LVDCD +         + GCNGGLM+ AFE+  + GG+  E +YPY   D    C   K    A S+     V  +++      V N P++VAI+A     Q Y  GV     C   LDHGV +VGYG+
Sbjct:   64 NAMHVHNANKMDKPYKLKLNKFADMTNHEFRNTYSGSKVKHHRMFRGGPRGNGTFMYEKVDTVPASVDWRKKGAVTSVKDQGQCGSCWAFSTIVAVEGINQIKTNKLVSLSEQELVDCDTD--------QNQGCNGGLMDYAFEFIKQRGGITTEANYPYEAYD--GTCDVSKENAPAVSIDGHENVPENDENALLKAVANQPVSVAIDAGGSDFQFYSEGVFTG-SCGTELDHGVAIVGYGT 295          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: ALEU_ARATH (Thiol protease aleurain OS=Arabidopsis thaliana GN=ALEU PE=1 SV=2)

HSP 1 Score: 152.91 bits (385), Expect = 1.567e-36
Identity = 97/224 (43.30%), Postives = 121/224 (54.02%), Query Frame = 2
Query:   53 GVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSL---DEDQIAANLVKNGPLAVAINAVY-MQTYIGGVSCPYICSRR---LDHGVVLVGYG 703
            GV QF+DLT  EF+RT LG  +             +    LP   DWRE G V PVKDQG CGSCW+FSTTGALE A   A GK +SLSEQQLVDC    +       + GCNGGL + AFEY    GGL  E+ YPYTG D    CKF    +   V N   ++L   DE + A  LV+  P+++A   ++  + Y  GV     C      ++H V+ VGYG
Sbjct:  103 GVNQFADLTWQEFQRTKLGAAQNCSATLKGSHK--VTEAALPETKDWREDGIVSPVKDQGGCGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGAFN-------NYGCNGGLPSQAFEYIKSNGGLDTEKAYPYTGKD--ETCKFSAENVGVQVLNSVNITLGAEDELKHAVGLVR--PVSIAFEVIHSFRLYKSGVYTDSHCGSTPMDVNHAVLAVGYG 313          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CPR2_ARATH (Probable cysteine proteinase At3g43960 OS=Arabidopsis thaliana GN=At3g43960 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.046e-36
Identity = 95/242 (39.26%), Postives = 138/242 (57.02%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATH--GVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTND-LPADFDWREKGAVGP-VKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKI--AASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVVLVGYGSA 709
            NL+R       DP+ ++  G+ +FSDLT  EF+ +YLG + + +   D  +       D LP + DWRE+GAV P VK QG CGSCW+F+ TGA+EG N + TG+LVSLSEQ+L+DCD        G+ + GC GG    AFE+  + GG++ +E Y YTG D   ACK  + K     ++    VV ++++      V   P++V I+A  M  Y  GV      +   DH V++VGYG++
Sbjct:   68 NLKRIEEHNS-DPNRSYERGLNKFSDLTADEFQASYLGGKMEKKSLSDVAERYQYKEGDVLPDEVDWRERGAVVPRVKRQGECGSCWAFAATGAVEGINQITTGELVSLSEQELIDCDR-------GNDNFGCAGGGAVWAFEFIKENGGIVSDEVYGYTGEDTA-ACKAIEMKTTRVVTINGHEVVPVNDEMSLKKAVAYQPISVMISAANMSDYKSGVYKGACSNLWGDHNVLIVGYGTS 300          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSP1_HOMAM (Digestive cysteine proteinase 1 OS=Homarus americanus GN=LCP1 PE=1 SV=2)

HSP 1 Score: 152.14 bits (383), Expect = 2.673e-36
Identity = 94/224 (41.96%), Postives = 127/224 (56.70%), Query Frame = 2
Query:   56 VTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLP--ADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGS-CDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKN-GPLAVAINAVY--MQTYIGGVSC-PYICSRRLDHGVVLVGYGS 706
            + QFSD+T  +F     G ++    P+ A  A    T+  P   + DWR KGAV PVKDQG CGSCW+FSTTG +EG +FL TG+LVSLSEQQLVDC         GS  + GCNGG +  A  Y    GG+  E  YPY   D  + C+F+ + I A+   +  ++   +       ++ GP++VAI+A +   Q+Y  GV   P   S +LDH V+ VGYGS
Sbjct:   69 INQFSDMTNEKFNAVMKGYKKG---PRPA--AVFTSTDAAPESTEVDWRTKGAVTPVKDQGQCGSCWAFSTTGGIEGQHFLKTGRLVSLSEQQLVDC-------AGGSYYNQGCNGGWVERAIMYVRDNGGVDTESSYPYEARD--NTCRFNSNTIGATCTGYVGIAQGSESALKTATRDIGPISVAIDASHRSFQSYYTGVYYEPSCSSSQLDHAVLAVGYGS 278          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CRUST_PANBO (Crustapain OS=Pandalus borealis GN=Cys PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.673e-36
Identity = 95/225 (42.22%), Postives = 120/225 (53.33%), Query Frame = 2
Query:   56 VTQFSDLTPAEFRRTYLGLRRKLR----LPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANF-SVVSLDEDQIAANLVKNGPLAVAINAVYMQ--TYIGGVSCPYIC-SRRLDHGVVLVGYGS 706
            +  FSDLT  E   T  G+ R+      LPK A      PT  + AD DWR KGAV PVKDQG CGSCW+FS   ALEGA+FL TG LVSLSEQ LVDC            + GCNGG    A++Y +   G+  E  YPY   D    C++D   I A+V+++    S DE  +   +   GP++V I+A      +Y GGV     C S   +H V  VGYG+
Sbjct:   69 INNFSDLTHEEVLATKTGMTRRRHPLSVLPKSA------PTTPMAADVDWRNKGAVTPVKDQGQCGSCWAFSAVAALEGAHFLKTGDLVSLSEQNLVDCSSSYG-------NQGCNGGWPYQAYQYIIANRGIDTESSYPYKAIDDN--CRYDAGNIGATVSSYVEPASGDESALQHAVQNEGPVSVCIDAGQSSFGSYGGGVYYEPNCDSWYANHAVTAVGYGT 278          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CATL6_HUMAN (Putative cathepsin L-like protein 6 OS=Homo sapiens GN=CTSLL6 PE=5 SV=3)

HSP 1 Score: 152.14 bits (383), Expect = 2.673e-36
Identity = 91/223 (40.81%), Postives = 121/223 (54.26%), Query Frame = 2
Query:   41 SATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINA--VYMQTYIGGVSCPYICS-RRLDHGVVLVGY 700
            S T  +  F D+T  EFR+   G + +        Q  +LP  ++P   DWREKG + PVKDQG CGSCW+FS TGALEG  F  TGKL+SL+EQ LVDC     P+     + GCNGG M++ F Y  + GGL  E  YPY G  +   C+++    AA+   F  +   E  +A  +   GP++VA  A  V  Q Y  G+     C    LDH ++LVGY
Sbjct:   15 SFTMAMNAFGDMTNEEFRQVMNGFQYQKHRKGKQFQERLLP--EIPTSVDWREKGYMTPVKDQGQCGSCWAFSATGALEGQMFWKTGKLISLNEQNLVDCS---GPQG----NEGCNGGFMDNPFRYVQENGGLDSEASYPYEG--KVKTCRYNPKYSAANDTGFVDIPSQEKDLAKAVATVGPISVAAGASHVSFQFYKKGIYFEPRCDPEGLDHAMLLVGY 226          
The following BLAST results are available for this feature:
BLAST of FC875476 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 163
Match NameE-valueIdentityDescription
CYSP3_HOMAM5.385e-3743.44Digestive cysteine proteinase 3 OS=Homarus america... [more]
CYSP2_LEIPI5.385e-3741.15Cysteine proteinase 2 OS=Leishmania pifanoi GN=CYS... [more]
CYSEP_PHAVU7.033e-3740.33Vignain OS=Phaseolus vulgaris PE=2 SV=2[more]
CATL_DROME7.033e-3742.11Cathepsin L OS=Drosophila melanogaster GN=Cp1 PE=1... [more]
CYSEP_RICCO9.186e-3739.92Vignain OS=Ricinus communis GN=CYSEP PE=1 SV=1[more]
ALEU_ARATH1.567e-3643.30Thiol protease aleurain OS=Arabidopsis thaliana GN... [more]
CPR2_ARATH2.046e-3639.26Probable cysteine proteinase At3g43960 OS=Arabidop... [more]
CYSP1_HOMAM2.673e-3641.96Digestive cysteine proteinase 1 OS=Homarus america... [more]
CRUST_PANBO2.673e-3642.22Crustapain OS=Pandalus borealis GN=Cys PE=1 SV=1[more]
CATL6_HUMAN2.673e-3640.81Putative cathepsin L-like protein 6 OS=Homo sapien... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D03EF CTVClemen1 Citrus clementina cDNA clone C31404D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875476 ID=FC875476|Name=FC875476|organism=Citrus clementina|type=EST|length=711bp
CAACTTGCGACGCGCCGCGCGTCGCCAGAAGCTCGACCCGAGCGCCACCC
ACGGCGTCACTCAGTTCTCCGACTTGACTCCGGCCGAGTTCCGCCGGACG
TACCTTGGCCTCAGGAGGAAGCTGAGGCTGCCTAAGGATGCGGATCAGGC
GCCGATCTTGCCTACGAATGATTTGCCGGCGGATTTTGATTGGAGAGAGA
AGGGCGCTGTAGGCCCTGTTAAAGATCAGGGTTCATGCGGATCATGCTGG
AGTTTCAGTACAACAGGGGCCTTGGAAGGTGCTAACTTCCTGGCAACTGG
AAAGCTTGTGAGCCTCAGTGAGCAACAGCTTGTGGATTGCGATCATGAGT
GTGATCCTGAGGAACCAGGTTCTTGTGATTCTGGATGCAATGGTGGGCTT
ATGAACAGTGCTTTTGAGTACACACTCAAGGCTGGTGGGCTTATGCGGGA
GGAAGACTATCCTTACACCGGCACTGATCGTGGCCACGCCTGCAAATTCG
ATAAGAGTAAGATTGCTGCCTCAGTGGCCAACTTCAGTGTTGTCTCCCTT
GATGAGGATCAAATTGCTGCCAATCTTGTGAAAAATGGTCCCCTTGCAGT
GGCCATCAATGCCGTGTACATGCAGACATACATTGGGGGAGTTTCCTGCC
CATACATATGCTCGAGGCGATTGGACCATGGAGTGGTGCTCGTGGGATAC
GGTTCAGCTGG
back to top