FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_PARBA (Heat shock 70 kDa protein 2 OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2)

HSP 1 Score: 375.555 bits (963), Expect = 1.462e-103
Identity = 193/234 (82.48%), Postives = 209/234 (89.32%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERLIGDAAKNQVAMNP+NTVFDAKRLIGR+F+D  VQ DMK +PFKVI   A KP+I V +KGEEKQF  EEISSMVL KMRE AE+YLG T+ NAVVTVPAYFNDSQRQATKDAG+IAGLNV+RIINEPTAAAIAYGLDKKA   GE+NVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLGGEDFDNR+VNHFV EFKRK + D+S N RALRRLRTA
Sbjct:   34 RTTPSFVAFTDTERLIGDAAKNQVAMNPSNTVFDAKRLIGRKFADPEVQSDMKHFPFKVI-DKAGKPVISVEFKGEEKQFTPEEISSMVLTKMRETAESYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDKKAE--GERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVNEFKRKHKKDLSSNARALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7A_CAEEL (Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2)

HSP 1 Score: 374.4 bits (960), Expect = 3.257e-103
Identity = 188/234 (80.34%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F D +VQ DMK WPFKVI+    KP + V YKGE K F  EEISSMVL+KM+E AEA+LG+T+K+AVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK    GE+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF  EFKRK + D++ NPRALRRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDPAVQSDMKHWPFKVISAEGAKPKVQVEYKGENKIFTPEEISSMVLLKMKETAEAFLGTTVKDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGH--GERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFCAEFKRKHKKDLASNPRALRRLRTA 267          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_EMENI (Heat shock 70 kDa protein OS=Emericella nidulans GN=hsp70 PE=1 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 4.254e-103
Identity = 192/234 (82.05%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRF DA VQ DMK WPFKV+   + KP+I V +KGE KQF  EEISSMVL KMRE AEA+LG T+ NAV+TVPAYFNDSQRQATKDAG+IAGLNV+RIINEPTAAAIAYGLDKK    GE+NVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR+VNHFV EFKRK + D+S N RALRRLRTA
Sbjct:   34 RTTPSFVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIGRRFGDAEVQADMKHWPFKVV-DKSGKPIIEVEFKGETKQFTPEEISSMVLTKMRETAEAFLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDKKVE--GERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFVTEFKRKHKKDLSTNARALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS7C1_DICDI (Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2)

HSP 1 Score: 374.015 bits (959), Expect = 4.254e-103
Identity = 189/234 (80.77%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGR+FSD  VQ DMK WPFKVI    DKP I V +KGE K F+ EEISSMVL+KM+E AEAYLG TI NAV+TVPAYFNDSQRQATKDAG I+ LNV RIINEPTAAAIAYGL+KK +  GEKN+LIFDLGGGTFDVSLLTIE+G+FEVKATAGDTHLGGEDFDNR+V+HFV EFKRK + DI GN RA+RRLRTA
Sbjct:   33 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRKFSDKEVQSDMKHWPFKVIPKDGDKPHIQVEFKGETKVFSPEEISSMVLLKMKETAEAYLGKTINNAVITVPAYFNDSQRQATKDAGTISKLNVQRIINEPTAAAIAYGLEKKGS--GEKNILIFDLGGGTFDVSLLTIEDGVFEVKATAGDTHLGGEDFDNRLVSHFVDEFKRKHKKDIMGNQRAVRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_ORYLA (Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 4.703e-102
Identity = 190/234 (81.20%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP+NTVFDAKRLIGRRF +  VQ DMK WPFKV++    KP I V+YKGE K F  EEISSMVL+KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV RIINEPTAAAIAYGLDK  +  GE+NVLIFDLGGGTFDVS+LTIE+GIFEVKATAGDTHLGGEDFDNRMVNHFV+EFKRK + DIS N RALRRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLIGRRFDEPVVQADMKHWPFKVVS-EGGKPKIQVDYKGENKTFFPEEISSMVLVKMKEIAEAYLGHKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVQRIINEPTAAAIAYGLDKGKS--GERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNHFVEEFKRKHKKDISQNKRALRRLRTA 268          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_SAGOE (Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 8.023e-102
Identity = 189/234 (80.77%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_RAT (Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 8.023e-102
Identity = 189/234 (80.77%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_PONAB (Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2)

HSP 1 Score: 369.777 bits (948), Expect = 8.023e-102
Identity = 189/234 (80.77%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLAKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_MOUSE (Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 8.023e-102
Identity = 189/234 (80.77%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_HUMAN (Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 8.023e-102
Identity = 189/234 (80.77%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF DA VQ DMK WPF V+   A +P + V YKGE K F  EE+SSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVV-NDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTA 266          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP72_PARBA1.462e-10382.48Heat shock 70 kDa protein 2 OS=Paracoccidioides br... [more]
HSP7A_CAEEL3.257e-10380.34Heat shock 70 kDa protein A OS=Caenorhabditis eleg... [more]
HSP70_EMENI4.254e-10382.05Heat shock 70 kDa protein OS=Emericella nidulans G... [more]
HS7C1_DICDI4.254e-10380.77Heat shock cognate 70 kDa protein 1 OS=Dictyosteli... [more]
HSP71_ORYLA4.703e-10281.20Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=... [more]
HSP7C_SAGOE8.023e-10280.77Heat shock cognate 71 kDa protein OS=Saguinus oedi... [more]
HSP7C_RAT8.023e-10280.77Heat shock cognate 71 kDa protein OS=Rattus norveg... [more]
HSP7C_PONAB8.023e-10280.77Heat shock cognate 71 kDa protein OS=Pongo abelii ... [more]
HSP7C_MOUSE8.023e-10280.77Heat shock cognate 71 kDa protein OS=Mus musculus ... [more]
HSP7C_HUMAN8.023e-10280.77Heat shock cognate 71 kDa protein OS=Homo sapiens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top