FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7D_DROME (Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3)

HSP 1 Score: 365.925 bits (938), Expect = 1.158e-100
Identity = 185/234 (79.06%), Postives = 206/234 (88.03%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPT T+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP I V YK E+K F  EEISSMVL KM+E AEAYLG T+ NAV+TVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDKKA  VGE+NVLIFDLGGGTFDVS+L+I++GIFEVK+TAGDTHLGGEDFDNR+V HFVQEFKRK + D++ N RALRRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLIGRKFDDAAVQSDMKHWPFEVVSADG-KPKIEVTYKDEKKTFFPEEISSMVLTKMKETAEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKA--VGERNVLIFDLGGGTFDVSILSIDDGIFEVKSTAGDTHLGGEDFDNRLVTHFVQEFKRKHKKDLTTNKRALRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_RAT (Heat shock 70 kDa protein 1A/1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=2)

HSP 1 Score: 365.925 bits (938), Expect = 1.158e-100
Identity = 185/234 (79.06%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+V+    DKP + VNYKGE + F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+V+HFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVV-NDGDKPKVQVNYKGENRSFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_CANFA (Heat shock 70 kDa protein 1 OS=Canis familiaris GN=HSPA1 PE=2 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.158e-100
Identity = 186/234 (79.49%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+V+    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEVKATAGDTHLGGEDFDNR+VNHFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVV-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7A_DROME (Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 1.513e-100
Identity = 187/234 (79.91%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FT++ERLIGDAAKNQVAMNP NT+FDAKRLIGRRF DA+VQ DMK WPF+V A    KP I V YKGE K F  EE+SSMVL KMRE AEAYLG T+ +AVVTVPAYFNDSQRQATKDAG IAGLNV+RIINEPTAAAIAYGLDK+ TS  E+NVLIFDLGGGTFDVS+LTIE+GIFEVKATAGDTHLGGEDFDNR+VNHFVQEF+RK + D+  N RALRRLRTA
Sbjct:   36 RTTPSYVAFTESERLIGDAAKNQVAMNPNNTIFDAKRLIGRRFDDATVQSDMKHWPFEVFAENG-KPRIRVEYKGERKSFYPEEVSSMVLTKMRETAEAYLGGTVTDAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKQGTS--ERNVLIFDLGGGTFDVSVLTIEDGIFEVKATAGDTHLGGEDFDNRLVNHFVQEFQRKHKKDLGQNKRALRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_NEUCR (Heat shock 70 kDa protein OS=Neurospora crassa GN=hsps-1 PE=2 SV=2)

HSP 1 Score: 365.54 bits (937), Expect = 1.513e-100
Identity = 188/234 (80.34%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERL+GDAAKNQVAMNP NTVFDAKRLIGR+FSD  VQ DMK +PFKVI     KP+I V +KGE K F  EEIS+M+L KM+E AEAYLG T+ NAVVTVPAYFNDSQRQATKDAG+IAGLNV+RIINEPTAAAIAYGLDKK    GE+NVLIFDLGGGTFDVSLLTIEEGIFEVK+TAGDTHLGGEDFDNR+VNHFVQEFKRK + D+S N RALRRLRTA
Sbjct:   34 RTTPSFVAFTDTERLVGDAAKNQVAMNPANTVFDAKRLIGRKFSDPEVQADMKHFPFKVI-DRGGKPVIQVEFKGETKVFTPEEISAMILQKMKETAEAYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIAYGLDKKVE--GERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFVQEFKRKHKKDLSTNARALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HS71B_BOSMU (Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 1.513e-100
Identity = 186/234 (79.49%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVA+NP NTVFDAKRLIGR+F D  VQ DMK WPF+VI    DKP + V+YKGE K F  EEISSMVL KM+EIAEAYLG  + NAV+TVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLD+  T  GE+NVLIFDLGGGTFDVS+LTI++GIFEV+ATAGDTHLGGEDFDNR+VNHFV+EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVI-NDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDR--TGKGERNVLIFDLGGGTFDVSILTIDDGIFEVEATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_TRIRU (Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 1.976e-100
Identity = 186/234 (79.49%), Postives = 205/234 (87.61%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPS+V FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGR+F+DA VQ DMK +PFKV+   + KP++ V +KGEEKQF  EEISSMVL KMRE AEAYLG T+ NAV+TVPAYFNDSQRQATKDAG+IAGLNV+RIINEPTA  IAYGLDKKA   GE+NVLIFD GGGTFDVSLLTIEEGIFEVK+TAGDT LGGE+FDNR+VNHFV EFKRK + D+S N RALRRLRTA
Sbjct:   34 RTTPSFVAFTDTERLIGDAAKNQVAMNPINTVFDAKRLIGRKFNDAEVQADMKHFPFKVVE-KSGKPIVQVEFKGEEKQFTPEEISSMVLTKMRETAEAYLGGTVNNAVITVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAGGIAYGLDKKAD--GERNVLIFDFGGGTFDVSLLTIEEGIFEVKSTAGDTQLGGEEFDNRLVNHFVNEFKRKNKKDLSTNARALRRLRTA 264          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_ONCMY (Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2)

HSP 1 Score: 365.155 bits (936), Expect = 1.976e-100
Identity = 186/234 (79.49%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRF D  VQ DMK WPF+VI   + +P + V YKGE K F  EEISSMVL+KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK  +  E+NVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDNRMVNHF+ EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDSERLIGDAAKNQVAMNPCNTVFDAKRLIGRRFDDGVVQSDMKHWPFEVI-NDSTRPKLQVEYKGETKSFYPEEISSMVLVKMKEIAEAYLGKTVNNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKVGA--ERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKYKKDISDNKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_CHICK (Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 3.371e-100
Identity = 186/234 (79.49%), Postives = 202/234 (86.32%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRF D+ VQ DMK WPF V+   A +P + V YKGE K F  EEISSMVL KM+EIAEAYLG T+ NAVVTVPAYFNDSQRQ TKDAG IAGLNV+RIINEPTAAAIAYGLDKK  +  E+N+LIFDLGGGTFDVS+LTIE GIFEVK+TAGDTHLGGEDFDNR+VNHF+ EFKRK + DIS N RA+RRLRTA
Sbjct:   36 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVV-NDAGRPKVQVEYKGETKSFYPEEISSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQGTKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGA--ERNLLIFDLGGGTFDVSILTIENGIFEVKSTAGDTHLGGEDFDNRLVNHFIAEFKRKHKKDISENKRAVRRLRTA 266          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_BOVIN (Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2)

HSP 1 Score: 364.385 bits (934), Expect = 3.371e-100
Identity = 182/234 (77.78%), Postives = 204/234 (87.18%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNT+FDAKRLIGR+F DA+VQ DMK WPF+V++    KP + V YKGE K F  EEISSMVL KM+EIAEAYLG  +++AV+TVPAYFNDSQRQATKDAG I GLNV+RIINEPTAAAIAYGLDKK  + GEKNVLIFDLGGGTFDVS+LTIE+GIFEVK+TAGDTHLGGEDFDN MV+H  +EFKRK + DI+ N RA+RRLRTA
Sbjct:   37 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVS-EGGKPKVQVEYKGEIKTFFPEEISSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNSMVSHLAEEFKRKHKKDIAPNKRAVRRLRTA 269          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP7D_DROME1.158e-10079.06Heat shock 70 kDa protein cognate 4 OS=Drosophila ... [more]
HSP71_RAT1.158e-10079.06Heat shock 70 kDa protein 1A/1B OS=Rattus norvegic... [more]
HSP71_CANFA1.158e-10079.49Heat shock 70 kDa protein 1 OS=Canis familiaris GN... [more]
HSP7A_DROME1.513e-10079.91Heat shock 70 kDa protein cognate 1 OS=Drosophila ... [more]
HSP70_NEUCR1.513e-10080.34Heat shock 70 kDa protein OS=Neurospora crassa GN=... [more]
HS71B_BOSMU1.513e-10079.49Heat shock 70 kDa protein 1B OS=Bos mutus grunnien... [more]
HSP70_TRIRU1.976e-10079.49Heat shock 70 kDa protein OS=Trichophyton rubrum G... [more]
HSP70_ONCMY1.976e-10079.49Heat shock cognate 70 kDa protein OS=Oncorhynchus ... [more]
HSP7C_CHICK3.371e-10079.49Heat shock cognate 71 kDa protein OS=Gallus gallus... [more]
HSP72_BOVIN3.371e-10077.78Heat shock-related 70 kDa protein 2 OS=Bos taurus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top