FC875583

Overview
NameFC875583
Unique NameFC875583
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length783
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: AVP_PHAAU (Pyrophosphate-energized vacuolar membrane proton pump OS=Phaseolus aureus PE=1 SV=3)

HSP 1 Score: 133.65 bits (335), Expect = 1.150e-30
Identity = 87/229 (37.99%), Postives = 120/229 (52.40%), Query Frame = 2
Query:   50 AQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFR----NTTPQQEASGIGRS-----NSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLF 709
            A+I +AI +GA  F  T+Y  +       A++IF ++L      +T+PQ  +    ++      +A  +  +FLLG + S ++G++GM                   +A   A R+G                     F ++ G D  G  +       + GYG G S +ALF ++GGGIYTKAADVGADLVGKVE+ IPEDDPRNPAVIAD VGDNVGD A  G+DLF
Sbjct:   75 AEIQNAISEGATSFLFTEYKYVGIFMVAFAILIF-LFLGSVEGFSTSPQACSYDKTKTCKPALATAIFSTVSFLLGGVTSLVSGFLGMKIATYANARTTLEARKGVGKAFITAFRSGAVMGFLLAANGLLVLYIAINLFKIYYGDDWGGLFEA------ITGYGLGGSSMALFGRVGGGIYTKAADVGADLVGKVERNIPEDDPRNPAVIADNVGDNVGDIAGMGSDLF 296          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA1_METAC (Pyrophosphate-energized proton pump 1 OS=Methanosarcina acetivorans GN=hppA1 PE=3 SV=2)

HSP 1 Score: 131.724 bits (330), Expect = 4.370e-30
Identity = 90/243 (37.04%), Postives = 118/243 (48.56%), Query Frame = 2
Query:   11 KWVLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAG---GFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLV-----GYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFEA 715
            K V ++  G   + +I+ +I  GA  +   QY  I+     LA++I  I                   +  +T A F+ GA+ S  AGY GM                    A +++  +G   G S              +  + Y             TDL LL +     G+  GAS +ALFA++GGGI+TKAADVGADLVGKVE GIPEDDPRNPAVIAD VGDNVGD A  GADL+E+
Sbjct:   24 KNVQNEGAGNDLIKKITASIHGGAMVYLNRQYRAIAVFVVFLAIIIALIL-----------------PNGALTAACFVFGAVLSATAGYAGMLTATIANGRTTNAATRGIGPAFRVSFASGTVMGMSVVGLGLFGLSLSFIILESVY-------------TDLDLLTIVNIVAGFSLGASSIALFARVGGGIFTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDIAGMGADLYES 236          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA_THEMA (Pyrophosphate-energized proton pump OS=Thermotoga maritima GN=hppA PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.271e-29
Identity = 89/242 (36.78%), Postives = 116/242 (47.93%), Query Frame = 2
Query:   17 VLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXX--EALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLG-VDTPG------SMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFEA 715
            V+ K EG   M +IS  IR GA+ F   +   I K+A ++A+++        TT Q              T  AFLLGA+ S  AG VGM                      AL++A + G                 +Y  F  W+G VD          +      + + GY  G S +A+F ++GGG+YTKAAD+ ADLVGK E  +PEDDPRNPA IAD VGDNVGD A  GADL E+
Sbjct:   25 VVRKPEGTERMKEISSYIRSGADSFLAHETKAIFKVAIVIAILLMIF-----TTWQ--------------TGVAFLLGAVMSASAGIVGMKMATRANVRVAEAARTTKKIGPALKVAYQGGSVMGLSVGGFALLGLVLVYLIFGKWMGQVDNLNIYTNWLGINFVPFAMTVSGYALGCSIIAMFDRVGGGVYTKAADMAADLVGKTELNLPEDDPRNPATIADNVGDNVGDVAGLGADLLES 247          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA_FUSNN (Pyrophosphate-energized proton pump OS=Fusobacterium nucleatum subsp. nucleatum GN=hppA PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.169e-29
Identity = 93/226 (41.15%), Postives = 117/226 (51.77%), Query Frame = 2
Query:   41 PEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXX-EALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFEA 715
            P++ +I+ AIR+GA  F   +Y           L++F I +         A  +G   S   T  AF+LGA+ S IAG  GM                    +AL +A   G                 ++    + L   T G + V D+     G+G GAS +ALFA++GGGIYTKAADVGADLVGKVE GIPEDDPRNPA IAD VGDNVGD A  GADLFE+
Sbjct:   37 PKVEEITAAIREGAMAFLAAEYKI---------LIVFVIVV---------AVALGIFISVP-TAGAFILGAITSAIAGNAGMRIATKANGRTAIAAKEGGLAKALNVAFSGGAVMGLTVVGLG------MFMLSLILLVSRTVG-ISVNDV----TGFGMGASSIALFARVGGGIYTKAADVGADLVGKVEAGIPEDDPRNPATIADNVGDNVGDVAGMGADLFES 232          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA_CHLTE (Pyrophosphate-energized proton pump OS=Chlorobium tepidum GN=hppA PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.933e-11
Identity = 35/70 (50.00%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  503 VGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFE 712
            +G+  G S  A   ++ GGI+TK AD+G+DL+ K+   I EDD RNP VIAD  GDN GD     AD FE
Sbjct:  162 IGFAIGESLGASVLRIAGGIFTKIADIGSDLM-KIVFKIKEDDARNPGVIADCTGDNAGDSVGPTADGFE 230          
The following BLAST results are available for this feature:
BLAST of FC875583 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
AVP_PHAAU1.150e-3037.99Pyrophosphate-energized vacuolar membrane proton p... [more]
HPPA1_METAC4.370e-3037.04Pyrophosphate-energized proton pump 1 OS=Methanosa... [more]
HPPA_THEMA1.271e-2936.78Pyrophosphate-energized proton pump OS=Thermotoga ... [more]
HPPA_FUSNN2.169e-2941.15Pyrophosphate-energized proton pump OS=Fusobacteri... [more]
HPPA_CHLTE5.933e-1150.00Pyrophosphate-energized proton pump OS=Chlorobium ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405E08EF CTVClemen1 Citrus clementina cDNA clone C31405E08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875583 ID=FC875583|Name=FC875583|organism=Citrus clementina|type=EST|length=783bp
ATATCTTTGTAAGTGGGTACTCTCAAAGGATGAGGGACCTCCAGAGATGG
CTCAGATATCAGATGCAATACGAGATGGAGCTGAAGGCTTCTTCAGGACC
CAGTATGGGACTATCTCTAAGATGGCATGTTTGCTTGCTTTGGTGATTTT
TTGCATTTACCTGTTTCGCAATACAACCCCTCAACAAGAAGCTTCTGGCA
TTGGGAGGTCAAATTCTGCCTGTATTACTGTTGCTGCATTCCTTTTGGGG
GCTTTATGTTCAGGAATTGCAGGATATGTAGGGATGTGGGTGTCTGTACG
TGCAAATGTTCGAGTGTCCAGTGCTGCAAGACGGTCTGCAAGAGAGGCAT
TGCAGATAGCTGTTCGTGCTGGTGGTTTCTCTGCTATTGTGGTTGTTGGT
ATGGCTGTAATTGGCATAGCCATCCTTTATGCCACATTTTATGTTTGGCT
TGGAGTGGATACACCAGGTTCAATGAAGGTTACTGATTTGCCTCTTCTTC
TTGTGGGGTATGGTTTTGGGGCTTCATTTGTTGCACTGTTTGCCCAGTTG
GGTGGTGGAATATACACAAAAGCTGCTGATGTTGGGGCAGATCTTGTTGG
GAAAGTGGAGCAGGGAATACCTGAAGATGATCCTCGGAATCCTGCTGTCA
TTGCAGATTTGGTTGGAGACAATGTGGGTGATTGTGCTGCACGGGGTGCT
GATCTTTTTGAAGCATGCAGCTGAAATATCAGTGCTTGATACTTGGGGAA
ACATGGGTCACGTGTAACTTGAAATCATCTGGC
back to top