FC875587

Overview
NameFC875587
Unique NameFC875587
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length712
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10270 contig Ccv1_Contig10270:1..712. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875587 vs. ExPASy Swiss-Prot
Match: RL19_PYRFU (50S ribosomal protein L19e OS=Pyrococcus furiosus GN=rpl19e PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.562e-26
Identity = 55/138 (39.86%), Postives = 86/138 (62.32%), Query Frame = 2
Query:   80 MVSLKLQKRLSASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAKRKGRHSGYGKRKGTREARLPTKIXXXXXXXXXXXXXXKYRESKKIDKHMYHDMYMKVKGNVFKNKRVL 493
            M +LK+Q+R++A +LKCG  ++W+DP  +++++ A +R++I++L+K+G I +KP K  SR RA+   E K+KGRH G G RKG + AR+  K               K +  KKID+  Y  +Y++ KG  FKNK  L
Sbjct:    1 MNTLKMQRRIAAEILKCGENRIWIDPERIDDVASAITREDIKRLIKEGVIKKKPIKGQSRYRAKIRHEQKKKGRHRGPGSRKGKKTARMGKKELWIKTIRALRKELRKLKAQKKIDRKTYRMLYIRAKGGQFKNKHQL 138          
BLAST of FC875587 vs. ExPASy Swiss-Prot
Match: RL19_MAIZE (60S ribosomal protein L19 (Fragment) OS=Zea mays GN=RPL19 PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 5.206e-24
Identity = 53/62 (85.48%), Postives = 59/62 (95.16%), Query Frame = 2
Query:   89 LKLQKRLSASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARR 274
            LKLQKRL+AS LKCG+GKVWLDPNEV+EISMANSRQNIRKLVKDGFII+KP KIHSRSR ++
Sbjct:    1 LKLQKRLAASYLKCGKGKVWLDPNEVSEISMANSRQNIRKLVKDGFIIKKPHKIHSRSRCKK 62          
BLAST of FC875587 vs. ExPASy Swiss-Prot
Match: RL19_ARCFU (50S ribosomal protein L19e OS=Archaeoglobus fulgidus GN=rpl19e PE=3 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.873e-22
Identity = 52/134 (38.81%), Postives = 78/134 (58.21%), Query Frame = 2
Query:   80 MVSLKLQKRLSASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAKRKGRHSGYGKRKGTREARLPTKIXXXXXXXXXXXXXXKYRESKKIDKHMYHDMYMKVKGNVFKN 481
            ++ L LQ+RL+ASVLKCG  +VW DP  + +I+ A ++Q+IR+L++ G I RKP    SR+R  + K  KRKGR  G+G RKG + AR+P K               + +    +D+  Y  +Y K KG  F++
Sbjct:    3 VMDLSLQRRLAASVLKCGENRVWFDPAALEDIATAATKQDIRELIEQGVIKRKPVNGVSRARINKRKLQKRKGRRRGHGSRKGAKGARMPRKRMWILRIRALRKALRQMKAEGVVDRRTYRILYRKAKGGEFRS 136          
BLAST of FC875587 vs. ExPASy Swiss-Prot
Match: RL19_METJA (50S ribosomal protein L19e OS=Methanocaldococcus jannaschii GN=rpl19e PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.418e-21
Identity = 47/135 (34.81%), Postives = 81/135 (60.00%), Query Frame = 2
Query:   80 MVSLKLQKRLSASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAKRKGRHSGYGKRKGTREARLPTKIXXXXXXXXXXXXXXKYRESKKIDKHMYHDMYMKVKGNVFKNK 484
            ++ + +Q+R++A +LKCG  +VW+DP +++ + MA S+ +IR L+K+G I +K  K  S +R +++KE ++KGR  G G R+G   AR P K               + R+S KID+ +Y  +Y   KG  F+++
Sbjct:    3 IMDVSVQRRMAAEILKCGIERVWIDPTQLDRVKMAMSKDDIRALIKEGVIKKKQKKGISSARVKKLKEQRKKGRRRGPGSRRGAAGARTPPKERWMATIRALRKTLKQLRDSGKIDRKVYRKLYRMAKGGAFRSR 137          
BLAST of FC875587 vs. ExPASy Swiss-Prot
Match: RL19_METTH (50S ribosomal protein L19e OS=Methanobacterium thermoautotrophicum GN=rpl19e PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.492e-20
Identity = 48/134 (35.82%), Postives = 78/134 (58.21%), Query Frame = 2
Query:   83 VSLKLQKRLSASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAKRKGRHSGYGKRKGTREARLPTKIXXXXXXXXXXXXXXKYRESKKIDKHMYHDMYMKVKGNVFKNK 484
            ++L  QKRL+A +LK G  ++W+DP  ++E+S A +R  +++L+KDG I  KP K  S  R++++ + K+KGR  G G  KG + AR P K               + R++++I+K  Y  +Y   KG  FK+K
Sbjct:    1 MNLTTQKRLAADILKVGVNRIWIDPERIDEVSRAITRDGVKQLIKDGAIKAKPKKGISSYRSKKIAQQKKKGRRRGPGSIKGAKGARRPKKDEWMTTIRALRKDLKEMRDNREINKSTYRKLYKMAKGGAFKSK 134          
BLAST of FC875587 vs. ExPASy Swiss-Prot
Match: RL19_METVA (50S ribosomal protein L19e OS=Methanococcus vannielii GN=rpl19e PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.957e-20
Identity = 45/134 (33.58%), Postives = 78/134 (58.21%), Query Frame = 2
Query:   83 VSLKLQKRLSASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAKRKGRHSGYGKRKGTREARLPTKIXXXXXXXXXXXXXXKYRESKKIDKHMYHDMYMKVKGNVFKNK 484
            + +  Q+R++A+VL CG  +VW+DP  + ++ MA ++ +IR L+ DG I++K  K  S +R + ++E KRKG+  G G R+G + AR P K               + RE++KI++  Y  +Y   KG  F+++
Sbjct:    1 MDVSTQRRIAAAVLDCGIDRVWVDPENLEKVKMAITKDDIRLLINDGIIVKKQEKGISSARKKEVQEQKRKGKRKGPGSRRGAKGARTPKKEKWMNTIRPLRTLLKELRENEKIERSSYRKLYRMAKGGAFRSR 134          
BLAST of FC875587 vs. ExPASy Swiss-Prot
Match: RL19_HALMA (50S ribosomal protein L19e OS=Haloarcula marismortui GN=rpl19e PE=1 SV=3)

HSP 1 Score: 78.1814 bits (191), Expect = 4.884e-14
Identity = 44/132 (33.33%), Postives = 65/132 (49.24%), Query Frame = 2
Query:   80 MVSLKLQKRLSASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAKRKGRHSGYGKRKGTREARLPTKIXXXXXXXXXXXXXXKYRESKKIDKHMYHDMYMKVKGNVF 475
            M  L  QKRL+A VL  G+ +VW +P    +I+ A +R+++R+LV +G I  K  K +SR RAR  ++ +  G   G G RKG   AR  +K               + R+   +    Y D+Y K  G  F
Sbjct:    1 MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEF 132          
BLAST of FC875587 vs. ExPASy Swiss-Prot
Match: RL19E_HALSA (50S ribosomal protein L19e OS=Halobacterium salinarium GN=rpl19e PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.884e-14
Identity = 48/145 (33.10%), Postives = 69/145 (47.59%), Query Frame = 2
Query:   80 MVSLKLQKRLSASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAKRKGRHSGYGKRKGTREARLPTKIXXXXXXXXXXXXXXKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKS 514
            M  L  QKRL+A VL  G  +VW DP+  +EI+ A +R++IR+LV DG I  + T+ +SR RAR     +  G   G G RKG   AR   K               + R+   +    Y +MY    G  F + R L   + ++
Sbjct:    1 MSDLSAQKRLAADVLDVGENRVWFDPDAQSEIADAITREDIRELVADGTIDAEDTQGNSRGRARERDAKESYGHKKGAGSRKGKAGARQNEKREYVAGIRAQRQQLRELRDDGTLSPAQYREMYNMANGGEFDSVRRLTNYVEEN 145          
BLAST of FC875587 vs. ExPASy Swiss-Prot
Match: RL19_SULAC (50S ribosomal protein L19e OS=Sulfolobus acidocaldarius GN=rpl19e PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.211e-13
Identity = 47/149 (31.54%), Postives = 71/149 (47.65%), Query Frame = 2
Query:   80 MVSLKLQKRLSASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAKR-KGRHSGYGKRKGTREARLPTKIXXXXXXXXXXXXXXKYRESKKIDKHMYHDMYMKVKGNVFKN----KRVLMESIHK 511
            M   +LQ+RL+A +   G   +  +P  + E+  A +R++I+KL+K+  +I  P +  S  R +  K  +R KG    +G RKG   AR   K                 R++  IDKH Y  +Y + KGN FKN    K  L +  HK
Sbjct:    1 MPEFQLQRRLAADIAGVGLNNIKFNPERLEEVEEALTREDIKKLIKERAVIVNPKRGISSGRLKERKHKRRSKGEGRKHGSRKGKSGARTGDKEIWINKIRKIRRYIRWLRDNNVIDKHTYRLLYKRAKGNYFKNLSDVKSYLRQMGHK 149          
BLAST of FC875587 vs. ExPASy Swiss-Prot
Match: RL19_AERPE (50S ribosomal protein L19e OS=Aeropyrum pernix GN=rpl19e PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.330e-11
Identity = 41/132 (31.06%), Postives = 65/132 (49.24%), Query Frame = 2
Query:   92 KLQKRLSASVLKCGRGKVWL--DPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAKRKGRHSGYGKRKGTREARLPTKIXXXXXXXXXXXXXXKYRESKKIDKHMYHDMYMKVKGNVFKN 481
            + Q+RL+A +L  G  ++W+  DP    EI  A ++ ++R L+K G I   P K ++   ++     +RKGR  G G+RKG   ARL  K                 R+ + ID+  Y  +YM  KG  F++
Sbjct:    4 RFQRRLAAEILGVGESRIWISPDPELREEIEGAVTKADVRALIKRGVIKVLPEKGNAGHASKVRHLQRRKGRRRGMGRRKGVATARLDPKERWMHRIRKIRRYLRYLRDKQVIDRKTYRRLYMLAKGGTFRD 135          
The following BLAST results are available for this feature:
BLAST of FC875587 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
RL19_PYRFU5.562e-2639.8650S ribosomal protein L19e OS=Pyrococcus furiosus ... [more]
RL19_MAIZE5.206e-2485.4860S ribosomal protein L19 (Fragment) OS=Zea mays G... [more]
RL19_ARCFU4.873e-2238.8150S ribosomal protein L19e OS=Archaeoglobus fulgid... [more]
RL19_METJA2.418e-2134.8150S ribosomal protein L19e OS=Methanocaldococcus j... [more]
RL19_METTH3.492e-2035.8250S ribosomal protein L19e OS=Methanobacterium the... [more]
RL19_METVA5.957e-2033.5850S ribosomal protein L19e OS=Methanococcus vannie... [more]
RL19_HALMA4.884e-1433.3350S ribosomal protein L19e OS=Haloarcula marismort... [more]
RL19E_HALSA4.884e-1433.1050S ribosomal protein L19e OS=Halobacterium salina... [more]
RL19_SULAC9.211e-1331.5450S ribosomal protein L19e OS=Sulfolobus acidocald... [more]
RL19_AERPE1.330e-1131.0650S ribosomal protein L19e OS=Aeropyrum pernix GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F01EF CTVClemen1 Citrus clementina cDNA clone C31405F01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875587 ID=FC875587|Name=FC875587|organism=Citrus clementina|type=EST|length=712bp
GCCTCCACTCTAACAGCAAAAACCCTTGTTGGTTGGCCACTGATCGCGAG
AGACAGAGGGGGAGAGAAGAGAAGGGAAAATGGTGTCGTTGAAGTTACAG
AAGCGGCTCTCCGCTAGCGTCCTCAAGTGCGGACGTGGCAAGGTCTGGCT
TGACCCTAATGAGGTCAACGAAATCTCCATGGCCAACTCCAGGCAGAACA
TTAGGAAATTGGTGAAGGATGGTTTCATCATCAGGAAGCCAACAAAGATC
CACTCCCGTTCTCGCGCTCGCAGAATGAAGGAAGCCAAGAGGAAGGGCCG
TCACTCTGGATATGGTAAGAGAAAGGGTACTAGGGAGGCGAGGCTTCCCA
CCAAAATCCTCTGGATGAGAAGGATGCGTGTGCTCAGGCGGTTGCTCCGC
AAATACCGTGAGTCGAAGAAAATTGACAAGCACATGTACCATGACATGTA
CATGAAGGTCAAGGGTAATGTATTTAAGAACAAGCGTGTCCTCATGGAGA
GTATCCACAAGTCAAAGGCTGAAAAGGCAAGAGAGAAGACTCTTTCTGAC
CAGTTTGAGGCTAAGCGCGCCAAGAACAAGGCCAGCAGGGAGAGAAAGCT
GGCCAGGAGAGAAGAGCGACTAGCACAGGGACCTGGAGAGAAGGCAGTAC
CAGCACCCCAACCAGCTGAGGGAGCTAAGAAGCTAAGAGTGATCGCTGAT
ACATCGATGATG
back to top