FC875589

Overview
NameFC875589
Unique NameFC875589
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length691
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11885 contig Ccv1_Contig11885:742..1432. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: MOV10_HUMAN (Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.603e-14
Identity = 52/169 (30.77%), Postives = 86/169 (50.89%), Query Frame = 1
Query:   25 IFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVT---VGIITPYKLQLK----CLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRAS--------NHGVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNCY 486
            I F  + G++   G S S+ N +EA       + L       G  +++   VG+I+PY+ Q++    C+    R +   ++ KDL + +V+ FQGQER VI++S VR+S        +  +GF+ + +R NVA+TRA+  L ++GN   L    DW   +   K    Y
Sbjct:  776 IIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPKRFNVAVTRAKALLIIVGNPLLLGHDPDWKVFLEFCKENGGY 944          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: HCS1_YEAST (DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae GN=HCS1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.158e-13
Identity = 44/104 (42.31%), Postives = 68/104 (65.38%), Query Frame = 1
Query:  121 EHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRAS-NHGVGFVADIRRVNVALTRARRALWVMGNAGAL 429
            EH++  L+S  + + ++G+I+PY  Q+  L+    + L      D+ I+TVD FQG+E+DVII+S VR++    VGF+ + RR+NVA+TR RR L V+GN   L
Sbjct:  554 EHIEN-LRSFNVPENSIGVISPYNAQVSHLKKLIHDELKLT---DIEISTVDGFQGREKDVIILSLVRSNEKFEVGFLKEERRLNVAMTRPRRQLVVVGNIEVL 653          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: DNA2L_XENLA (DNA2-like helicase OS=Xenopus laevis GN=dna2 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.158e-13
Identity = 55/150 (36.67%), Postives = 78/150 (52.00%), Query Frame = 1
Query:   52 ESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRASNHGV--GFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNCYMDM 495
            E+   G +S  N  EAK    L  HL K     G     +GII PY+ QLK + + F    NS     + +NTVD +QG+++ VII+S VR++  G     + D RR+NVALTRA+  L ++G    L + D    LI + K  N   D+
Sbjct:  904 ETEEKGGIS--NWIEAK----LVFHLTKLYLKAGCRPSDIGIIAPYRQQLKMISNYF----NSLSASAVEVNTVDKYQGRDKSVIIVSFVRSNIDGKLGDLLKDWRRLNVALTRAKHKLIMLGCVPTLNRFDCLEQLICNLKTENQIYDL 1043          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: M10L1_HUMAN (Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10L1 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.799e-13
Identity = 55/168 (32.74%), Postives = 87/168 (51.79%), Query Frame = 1
Query:   25 IFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRASN-------HGVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNCYMDMDSLP 507
            + F  + G E+  G S S+ N  EA   V  Y  L     S  +    +G+ITPY+ Q++ ++   RNV    +  D+ + +V+ FQGQE  VII+S VR++        + +GF+++ +R NVA+TR +  L V+GN   L +   + AL+  S     YM  D  P
Sbjct: 1016 LIFHGVRGSEAREGKSPSWFNPAEA-VQVLRYCCLLAHSISSQVSASDIGVITPYRKQVEKIRILLRNV----DLMDIKVGSVEEFQGQEYLVIIISTVRSNEDRFEDDRYFLGFLSNSKRFNVAITRPKALLIVLGNPHVLVRDPCFGALLEYSITNGVYMGCDLPP 1178          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: MOV10_CHICK (Putative helicase MOV-10 OS=Gallus gallus GN=MOV10 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.560e-12
Identity = 59/188 (31.38%), Postives = 97/188 (51.60%), Query Frame = 1
Query:   25 IFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMG------LGKVTVGIITPYKLQLKCLQHEFRN---VLNS-EEGKDLYINTVDAFQGQERDVIIMSCVRASNH--------GVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALI---ADSKARNCYMDMDSLPKEFSVA 525
            I F  + G +     S S+ N  E +  V   ++LQK L+S G      +    +GII+PY+ Q++ ++    +   VL +  +   L + +V+ FQGQER VI++S VR+ +          +GF+ + +R+NVALTRA+  L V+GNA  L++   W   +    D  A   Y   +  P+E S+A
Sbjct:  773 IIFHGVCGEDEREAKSPSFFNTAEIEVVV---QYLQKLLQSQGRRGCPTISPKEIGIISPYRKQVEKIRLAITSKDPVLRALPDIGQLKVGSVEEFQGQERRVILISTVRSCSEYLQLDQTFRLGFLKNPKRLNVALTRAKALLIVVGNAAVLSKDPHWHRFLRYCRDEGAYRGYPYEEEPPEEDSLA 957          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: M10L1_MOUSE (Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.367e-12
Identity = 51/169 (30.18%), Postives = 88/169 (52.07%), Query Frame = 1
Query:   25 IFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRASN-------HGVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNCYMDMDSLPK 510
            + F  + G E+  G S S+ +  EA   V  Y  L     S  +    +G+ITPY+ Q++ ++   RNV    +  D+ + +V+ FQGQE  VI++S VR++        + +GF+++ +R NVA+TR +  L ++GN   L +   + AL+  S +   Y   D  P+
Sbjct: 1018 LIFHGVRGNEAREGRSPSWFSPAEA-VQVMRYCCLLARSVSSQVSSKDIGVITPYRKQVEKIKILLRNV----DLTDIKVGSVEEFQGQEYLVIVISTVRSNEDRFEDDRYFLGFLSNSKRFNVAITRPKALLIILGNPHVLVRDPCFGALLEYSVSNGVYTGCDLPPE 1181          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: MV10A_DANRE (Putative helicase mov-10-A OS=Danio rerio GN=mov10a PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 5.703e-12
Identity = 51/157 (32.48%), Postives = 83/157 (52.87%), Query Frame = 1
Query:   19 PYIFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVT---VGIITPYKLQLKCLQHEFR--NVLNSEEG-KDLYINTVDAFQGQERDVIIMSCVRASNH--------GVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDW 447
            P IF  V+ G++     S S+ N  E    +   + L  T    G+ K++   +GII PY+ Q++ ++   +    L S  G ++L + +V+ FQGQER VII+S VR+S           +GF+ + +R NVA+TRA+  L ++GN   L   + W
Sbjct:  797 PVIFHGVV-GKDERESTSPSFFNTSEIDKIMDYLKKLLLTQAKKGIAKISPKDIGIIAPYRKQVEKIRQAIKIHRELKSLSGIEELKVGSVEEFQGQERKVIIVSTVRSSKEHIILDDKFNIGFLKNEKRFNVAVTRAKALLIMVGNPIILRTDEIW 952          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: MV10B_DANRE (Putative helicase mov-10-B OS=Danio rerio GN=mov10b PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.271e-11
Identity = 46/162 (28.40%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   25 IFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKV---TVGIITPYKLQLKCLQH------EFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRAS--------NHGVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALI 459
            + F  + G++     S S+ N+ E    V   + L  T    G+ ++    +GII PY+ Q++ ++       +F++ +  +   +L + +V+ FQGQER VI++S VR+S           +GF+ + +R NVA+TRA+  L ++GN   L   + W   I
Sbjct:  803 VIFHGVPGKDERESNSPSFFNIYEINILVDYLKKLLLTQPKKGISRIFPKDIGIIAPYRKQVEKIKRAIDADKDFQDYMGID---NLKVGSVEEFQGQERKVIMVSTVRSSVKYISLDETFNIGFLKNEKRFNVAVTRAKSLLIMVGNPMILRTDESWGRFI 961          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: ARMI_DROME (Probable RNA helicase armi OS=Drosophila melanogaster GN=armi PE=2 SV=3)

HSP 1 Score: 69.707 bits (169), Expect = 1.659e-11
Identity = 45/121 (37.19%), Postives = 64/121 (52.89%), Query Frame = 1
Query:  169 VGIITPYKLQLKCLQHEFRNVLNSEEGKDLY---INTVDAFQGQERDVIIMSCVRASNH--------GVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNCYMDMD 498
            +GIITPY+ Q+K L+  F        G D+    I +V+ FQGQERD+I++S VR+S           +GFV   +R+NVA++RAR  + + GN   L   + W  LI      N Y   D
Sbjct: 1131 IGIITPYQKQVKMLRSMFI-------GTDVVMPKIGSVEEFQGQERDIILISTVRSSEEILRMDARFSLGFVRCSKRLNVAVSRARAMMIIFGNPHLLAVDECWRQLILFCVKNNAYFGCD 1244          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: ZNFX1_HUMAN (NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 4.828e-11
Identity = 46/138 (33.33%), Postives = 76/138 (55.07%), Query Frame = 1
Query:   76 SYQNVDEAKFGV--CLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRASNHG-VGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARN 480
            S+QN  EA F V  C Y   Q+ L S       + I+T Y  QL CL    R ++ ++    + ++ VD +QG+E D+I++S VR++  G VGF+    R+ VAL+RA++ ++ +GN   L +   W+ +I   +  N
Sbjct: 1127 SHQNQHEAHFVVELCKYFLCQEYLPSQ------ITILTTYTGQLFCL----RKLMPAKTFAGVRVHVVDKYQGEENDIILLSLVRSNQEGKVGFLQISNRICVALSRAKKGMYCIGNMQMLAKVPLWSKIIHTLRENN 1254          
The following BLAST results are available for this feature:
BLAST of FC875589 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
MOV10_HUMAN1.603e-1430.77Putative helicase MOV-10 OS=Homo sapiens GN=MOV10 ... [more]
HCS1_YEAST5.158e-1342.31DNA polymerase alpha-associated DNA helicase A OS=... [more]
DNA2L_XENLA5.158e-1336.67DNA2-like helicase OS=Xenopus laevis GN=dna2 PE=1 ... [more]
M10L1_HUMAN8.799e-1332.74Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10... [more]
MOV10_CHICK2.560e-1231.38Putative helicase MOV-10 OS=Gallus gallus GN=MOV10... [more]
M10L1_MOUSE4.367e-1230.18Putative helicase Mov10l1 OS=Mus musculus GN=Mov10... [more]
MV10A_DANRE5.703e-1232.48Putative helicase mov-10-A OS=Danio rerio GN=mov10... [more]
MV10B_DANRE1.271e-1128.40Putative helicase mov-10-B OS=Danio rerio GN=mov10... [more]
ARMI_DROME1.659e-1137.19Probable RNA helicase armi OS=Drosophila melanogas... [more]
ZNFX1_HUMAN4.828e-1133.33NFX1-type zinc finger-containing protein 1 OS=Homo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F03EF CTVClemen1 Citrus clementina cDNA clone C31405F03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875589 ID=FC875589|Name=FC875589|organism=Citrus clementina|type=EST|length=691bp
AAGGATCCCGTACTTAGGCCTTACATATTTTTTGATGTCATTCATGGGAG
GGAGTCCCATAGAGGTGGATCTGTTTCTTATCAAAACGTTGATGAAGCAA
AATTTGGTGTTTGCTTGTATGAGCATCTTCAGAAAACTCTGAAGTCTATG
GGTTTGGGGAAAGTCACTGTAGGCATCATTACACCATACAAGCTGCAATT
GAAATGCCTTCAACATGAGTTCCGTAATGTTTTAAATTCAGAAGAAGGAA
AAGATTTATATATTAATACTGTTGATGCTTTCCAAGGCCAAGAGCGTGAT
GTAATTATCATGTCTTGCGTGCGAGCATCAAATCATGGGGTTGGCTTTGT
TGCAGATATTCGACGTGTGAATGTTGCTCTTACTCGTGCAAGAAGAGCTC
TTTGGGTTATGGGAAATGCCGGTGCTCTCACACAATCTGATGATTGGGCT
GCATTGATTGCTGATTCGAAAGCAAGGAATTGTTATATGGACATGGACTC
CCTCCCTAAAGAGTTTTCTGTAGCACTAGCAGCAAAGGCACCAGGTTATG
GTCCATTGCAGGGCAAGATTCCCCATAATGCAAGGGGCTTGAGATCTGCT
GGGCAAAGACATCGATCATTCGATATGAATATGGAGTCCAGGTCTGGAAC
ACCATCAGAAGATGATGAGAAGGTATCTAGAAANTGGAATT
back to top