FC875592

Overview
NameFC875592
Unique NameFC875592
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length670
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig108 contig Ccv1_Contig108:372..1041. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB22_CUCSA (Chlorophyll a-b binding protein of LHCII type 1 (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.763e-82
Identity = 142/148 (95.95%), Postives = 146/148 (98.65%), Query Frame = 2
Query:  227 PFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            PFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH  WAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDP+YPGGSFDPLGLADDPEAFA
Sbjct:    1 PFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSTWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFA 148          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB2_MALDO (Chlorophyll a-b binding protein AB10, chloroplastic OS=Malus domestica PE=3 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 7.865e-72
Identity = 142/194 (73.20%), Postives = 152/194 (78.35%), Query Frame = 2
Query:   89 VGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            + K   L P  + L      +M K  +KS  S S      RVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSA PETFAKNRELEVIH R AM  ALGC+FPELL+  G  FGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIW  +V+LMGAVEGYRIA GPLGEVTDPLYP GSFD LGLA+D EAFA
Sbjct:   20 IAKPSKLNPISSTLIVTAGFTMLKHAAKSKVSSSTC--DRRVKYLGPFSGEWPSYLTGEFPGDYGWDTAGLSAYPETFAKNRELEVIHSRCAMSAALGCIFPELLSVMGQGFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWTTKVILMGAVEGYRIARGPLGEVTDPLYP-GSFDSLGLAEDTEAFA 210          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB2_CHLRE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas reinhardtii GN=cabII-1 PE=3 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 1.027e-71
Identity = 129/176 (73.30%), Postives = 148/176 (84.09%), Query Frame = 2
Query:  155 RKTGSKSV---SSGSPWYGPDRVKYLGPFS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            +KT +K+    SSG  +YGP+R K+LGP+S    P+YLTGEFPGDYGWDTAGLSADPETF + RELE+IH RWAMLGALGC  PELLA++G KFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQ+I+A  A QV+LMG +EGYR+ GGP GE  DPLYPG SFDPLGLADDP+ FA
Sbjct:   20 KKTAAKAAAPKSSGVEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCQTPELLAKSGTKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQNIVATSAVQVILMGLIEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFA 195          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB2_CHLMO (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas moewusii PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.483e-70
Identity = 127/165 (76.97%), Postives = 140/165 (84.85%), Query Frame = 2
Query:  179 SSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARN-GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            S+G  WYGPDR K+LGPFS   P+YLTGEFPGDYGWDTAGLSADPETF K RELEVIH RWA+LGALG + PELL+   GVKFGE VWFKAGAQIFSEGGLDYLG+P+LIHAQ+I+A  A QVVLMG +EGYR+ GGP GE  DPLYPG SFDPLGLADDP+ FA
Sbjct:   34 SAGIEWYGPDRAKWLGPFSTNTPAYLTGEFPGDYGWDTAGLSADPETFKKYRELEVIHARWALLGALGILTPELLSTYAGVKFGEPVWFKAGAQIFSEGGLDYLGSPALIHAQNIVATLAVQVVLMGLIEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFA 198          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB23_SOLLC (Chlorophyll a-b binding protein 13, chloroplastic OS=Solanum lycopersicum GN=CAB13 PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.697e-66
Identity = 131/208 (62.98%), Postives = 155/208 (74.52%), Query Frame = 2
Query:   56 ATSTMALSSSFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGP-LGEVTDPLYPGGS-FDPLGLADDPEAFA 670
            +++T+  ++ F+G+  N  P  + ++ G         ++   S   WYGPDRVKYLGPFS + PSYL GEFPGDYGWDTAGLSADPE FAKNR LEVIH RWAMLGALGC+FPE+L +   V F E VWFKAG+QIFS+GGLDYLGNP+L+HAQSILA+   QVVLMG VEG+RI G P +GE  D LYPGG  FDPLGLADDP  FA
Sbjct:    9 SSTTVVKATPFLGQTKNANPLRDVVAMGS--------ARFTMSNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCIFPEVLEKWVKVDFKEPVWFKAGSQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLPGVGEGND-LYPGGQYFDPLGLADDPTTFA 207          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB23_HORVU (Chlorophyll a-b binding protein of LHCII type III, chloroplastic OS=Hordeum vulgare GN=LHBC PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 3.781e-66
Identity = 135/211 (63.98%), Postives = 157/211 (74.41%), Query Frame = 2
Query:   53 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSP-WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGS-FDPLGLADDPEAFA 670
            MA++ MA +S + V K   L+  G   S      +    +  ++ G+  WYGPDRVKYLGPFS + PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALGCVFPE+L +  GV+F E VWFKAG+QIFSEGGLDYLGNP+L+HAQSILA+   QV+LMG VEG+RI G   +GE  D LYPGG  FDPLGLADDP  FA
Sbjct:    1 MASTIMAAASRAVVAKTPFLSGQGRAASASPLRDIAAATNGRITMGNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCVFPEVLQKWVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFRINGLDGVGEGND-LYPGGQYFDPLGLADDPVTFA 210          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.065e-60
Identity = 115/163 (70.55%), Postives = 133/163 (81.60%), Query Frame = 2
Query:  194 WYGPDRVKYLGPFS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLG--EVTDPLYPGGSFDPLGLADDPEAFA 670
            +YGPDR K+LGPFS  + P YLTGEFPGDYGWDTAGLSADP+TFA+ RE+E+IH RWA+LGALG + PELL++  GV+FGE VWFKAGAQIF++GGL+YLGN SLIHAQSI+A  A QVVLMG  E YR  GG  G  +  D LYPGG FDPLGLADDP+ FA
Sbjct:   33 FYGPDRAKFLGPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYRANGGSEGFLDDLDTLYPGGPFDPLGLADDPDTFA 195          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB2_DUNSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella salina PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 4.949e-58
Identity = 115/173 (66.47%), Postives = 132/173 (76.30%), Query Frame = 2
Query:  158 KTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEA-VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            K  SKS SS + +YGPD          + P   TGEFPGDYGWDTAGLSADPETF + RELE+IH R  +LGALG V PELLA  +G+KFG+A +WFKAGA IF +GGL+YLGNPSLIHAQ+I+A  A QVVLMG VEGYR+ GGP GE  DPLYPG +FDPLGLADDP+ FA
Sbjct:   45 KAVSKSSSSANQFYGPDATSGWD-LQHQHPRLPTGEFPGDYGWDTAGLSADPETFKRYRELELIHARCGLLGALGMVTPELLADEDGIKFGDAAIWFKAGAAIFQDGGLNYLGNPSLIHAQNIVATLAVQVVLMGLVEGYRVNGGPAGEGLDPLYPGEAFDPLGLADDPDTFA 216          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB22_PINSY (Chlorophyll a-b binding protein type 2 member 2 (Fragment) OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.972e-42
Identity = 80/92 (86.96%), Postives = 85/92 (92.39%), Query Frame = 2
Query:  395 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            ELL +NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQVVLMG +EGYR+ GGPLGE  DPLYPG +FDPLGLADDPEA A
Sbjct:    1 ELLVKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGDAFDPLGLADDPEAKA 92          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.228e-32
Identity = 85/173 (49.13%), Postives = 100/173 (57.80%), Query Frame = 2
Query:  167 SKSVSSGSP----WYGPDRVKYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPE 661
            SK+VS  S     WYGPDR  +L        E P YL GE  GDYG+D  GL   PE FAK +  E+IH RWAMLGA G + PE L + G   G EAVWFK GA +     L+Y G    I    +LA+ A +VVL+G  E YRI  G   +  D L+PGG FDPLGLA DPE
Sbjct:   49 SKAVSETSDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVLAVVA-EVVLLGGAEYYRITNGL--DFEDKLHPGGPFDPLGLAKDPE 216          
The following BLAST results are available for this feature:
BLAST of FC875592 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
CB22_CUCSA3.763e-8295.95Chlorophyll a-b binding protein of LHCII type 1 (F... [more]
CB2_MALDO7.865e-7273.20Chlorophyll a-b binding protein AB10, chloroplasti... [more]
CB2_CHLRE1.027e-7173.30Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2_CHLMO1.483e-7076.97Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB23_SOLLC1.697e-6662.98Chlorophyll a-b binding protein 13, chloroplastic ... [more]
CB23_HORVU3.781e-6663.98Chlorophyll a-b binding protein of LHCII type III,... [more]
CB2_DUNTE1.065e-6070.55Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2_DUNSA4.949e-5866.47Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB22_PINSY4.972e-4286.96Chlorophyll a-b binding protein type 2 member 2 (F... [more]
CB26_ARATH1.228e-3249.13Chlorophyll a-b binding protein CP26, chloroplasti... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F06EF CTVClemen1 Citrus clementina cDNA clone C31405F06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875592 ID=FC875592|Name=FC875592|organism=Citrus clementina|type=EST|length=670bp
ACCTCTCAACACTCGAACACTAGAGCCCACCAACAACTCTGATCATTGCA
AAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAGGCT
GTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCATCTC
CATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGCAGCCCGTGGTACG
GCCCGGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCAAGC
TACTTGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACACAGCCGGGCT
TTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCATCC
ACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCTC
TTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCGGG
AGCTCAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAAGCT
TGATCCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTCTTG
ATGGGAGCTGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGAAGT
GACCGACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGGCTG
ATGACCCGGAGGCTTTTGCT
back to top