FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOCS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=sucC PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.054e-42
Identity = 96/236 (40.68%), Postives = 141/236 (59.75%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGL--KGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+ KYG+ VP+G    +++E +   +++       VVKSQI AGGRG G FK     KGGV +VK  ++V      MLG++LVTKQTGP+GK V ++Y+ E   +  E+Y +++LDR T+   I+  ++GG  IE++A   P  IVKV ID   G+    A KV   L  +        + +  +YK F + D +L+E+NPL  T   +++A DAK+NFDDNA +R
Sbjct:    1 MNIHEYQAKSLLKKYGVAVPRGGVAYTLEEARAVAKEL--GGPVWVVKSQIHAGGRGAGRFKDDPNGKGGVRVVKSIDDVVASTDAMLGKVLVTKQTGPEGKEVKRIYVEEGADIKRELYLSMLLDRATSRITIVASTEGGMEIEEVAHTSPEKIVKVAIDPVQGLQGYHARKVAFALGLEGKQVGACTKFLLGMYKAFTDLDMSLVEVNPLVVTGSGEVLALDAKVNFDDNALYR 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BARHE (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella henselae GN=sucC PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.054e-42
Identity = 98/237 (41.35%), Postives = 141/237 (59.49%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+ +YG  +  G+AV SV++ +K  + +       VVKSQI AGGRG G FK      KGGV + K  EEV     +MLG+ LVTKQTGP+GK V+++Y+ +   +  E+Y ++++DR       +  ++GG  IE +AE+ P  I+ +PI+   G+T  D A++ D L    + R D  +    LYK FCE D +LLEINPL   +   L   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHEYGAPIANGVAVYSVEQAEKWAKKL--PGPLYVVKSQIHAGGRGKGKFKELDPDAKGGVRLAKSVEEVVANVKEMLGKTLVTKQTGPEGKQVNRLYIEDGADIERELYLSLLVDRNVGRVAFVVSTEGGMDIETVAEETPEKILTLPINSTQGVTSSDCARLCDALDLHDSAREDGEKLFPILYKAFCEKDMSLLEINPLIVMTNGHLRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BARBK (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=sucC PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.054e-42
Identity = 101/237 (42.62%), Postives = 140/237 (59.07%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+ +YG  V  G+AV SV++ +K  + +       VVKSQI AGGRG G FK   S  KGGV + K  EEV     +MLG+ LVTKQTGP+GK V+++Y+ +  ++  E+Y ++++DR T     +  ++GG  IE +A + P  I  + ID   G+TD D  K+ D L      R D  +    LYK FCE D +LLEINPL      +L   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHEYGAPVANGVAVYSVEQAEKWAKKL--PGPLYVVKSQIHAGGRGKGNFKELDSDAKGGVRLAKSVEEVVANVKEMLGKTLVTKQTGPEGKQVNRLYIEDGANIERELYLSLLIDRTTGRVAFVVSTEGGMDIETVAAETPEKICTLSIDPAEGVTDADCVKLCDELNLSGNAREDGEKLFPILYKAFCEKDMSLLEINPLIVMDDGRLRVLDAKVSFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACHD (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacillus halodurans GN=sucC PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.374e-41
Identity = 99/241 (41.08%), Postives = 141/241 (58.51%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            +NIHEYQG EL+ +YG+ VP G    SVDE  +A +++       VVK+QI AGGRG         GGV + K  +EV   A ++LG+ LVT QTGP+GK V ++ + E   +  E Y  ++LDR T+  +++   +GGT IE++AEK P  I K  ID   G+    A ++   +         A++ +  LYK+F E DC++ EINPL  T   +++A DAKLNFD NA +RQK  L F
Sbjct:    1 MNIHEYQGKELLRQYGVAVPNGKVAFSVDEAVEAAKEL--GSNVCVVKAQIHAGGRGKA-------GGVKVAKNLDEVRTYADEILGKTLVTHQTGPEGKEVKRLLIEEGCDIQKEYYVGLVLDRATSRVVMMASEEGGTEIEEVAEKTPEKIFKEIIDPVVGLQGFQARRLAFNINIPKELVGQAVKFMLGLYKVFVEKDCSIAEINPLVTTGDGKVMALDAKLNFDSNALYRQKAILEF 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CHLT3 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=sucC PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.794e-41
Identity = 92/241 (38.17%), Postives = 146/241 (60.58%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKE--LVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG E++  +G+ VPKG+   S +E KKA + +  +     +VVK+QI AGGRG         GGV +V+  +E  ++A +M+G  LVT QTGP+GK V ++ + E +++  E+Y  I LDR T+  +++  ++GG  IE +AE+ P  ++K+ I    G+    A +    L  +     +A++ +  LY  + ++DC+L EINPL  T   +++A DAK+NFDDNA FR K Y+
Sbjct:    1 MNIHEYQGKEILRGFGVTVPKGIVAFSAEEAKKAAETLLTEQGGGVVVVKAQIHAGGRGKA-------GGVKLVRSADEAFEVATQMIGTTLVTHQTGPEGKEVRRLLVEEGMNIEKELYLGITLDRATSCNVLMVSTEGGMEIEKVAEETPEKLLKIQIHPTLGLQPNQAREAAFFLGLEGEQFKNAVKFISALYNAYMKADCSLAEINPLVVTKEGRVIALDAKINFDDNALFRHKDYI 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_PARDP (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Paracoccus denitrificans (strain Pd 1222) GN=sucC PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.343e-41
Identity = 98/238 (41.18%), Postives = 137/238 (57.56%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            +NIHEYQ   L+ +YG  V  G  V   DE K A  ++  D    VVK+QI AGGRG G FK   +G KGGV + K  EE E+LA +MLG+ LVT QTG  GK V+++Y+ +   +  E+Y A+++DR T+    +  ++GG  IE++A   P  IV   +D  +G++D    +V   L    A     +  VK LY++F E D  +LEINPL       L A DAK+ FD+NA +RQ
Sbjct:    1 MNIHEYQAKALLRQYGAPVSDGRVVMKADEAKAAAGEL--DGPLWVVKAQIHAGGRGKGHFKEKEAGEKGGVRLAKSVEEAEELARQMLGRTLVTHQTGETGKQVNRIYIEDGSDIERELYLALLVDRGTSRVSFVASTEGGMDIEEVAASTPEKIVSFSVDPASGLSDFHGRRVAFALGLSGAQVKQCVALVKNLYRMFIEKDMEMLEINPLIVMKDGNLKALDAKMGFDNNALYRQ 236          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_GEOLS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=sucC PE=3 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.997e-41
Identity = 95/238 (39.92%), Postives = 141/238 (59.24%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRY 739
            +NIHEYQ  E+++ YGI VP+     + D+V++A + +   H   VVK+QI AGGRG         GGV +V   E+  D+A ++ G+ LVTKQTGP+G  V ++ + E + +  E Y +I LDR+T+   +I  ++GG  IE++A+K P+ I  + ID F G+    A K+   L    A   D +E +   YK   E DC+L+EINPL  T    L+A DAK++FDDNA +R + Y
Sbjct:    1 MNIHEYQAKEILSTYGIPVPRNRVALTADQVERAAK-MMGGH--CVVKAQIYAGGRGKA-------GGVKLVHHPEQASDVAKELFGKRLVTKQTGPEGLKVRRILVEETVEIAREFYLSITLDRETSRYCLIASAEGGMDIEEVAQKSPDKIHVLTIDPFTGLRTYQARKIALALGLSGAVCEDCVELILNTYKCCLEKDCSLIEINPLVVTRAGWLLAMDAKISFDDNAVYRHREY 228          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_CHLL2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=sucC PE=3 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.997e-41
Identity = 93/241 (38.59%), Postives = 145/241 (60.17%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKE--LVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG +++ K+G++VP+G+   S DE K+A Q +F +     +VVK+QI AGGRG         GGV + K  +E  ++A +MLG  LVT QTGP+GK VS++ + E +++  E Y  I LDR T+  +++  ++GG  IE +AE+ P+ ++K+ +D   G+    A +    L  +     +A+  +  LY  +   D +L EINPL  T   +++A DAK+NFD NA FR K +L
Sbjct:    1 MNIHEYQGKDILKKFGVSVPRGIVAFSPDEAKQAAQQLFEEQGSPVVVVKAQIHAGGRGKA-------GGVKLAKSPDEAMEIARQMLGATLVTHQTGPEGKQVSRLLVEEGMNIDREFYVGITLDRSTSRNVLMVSTEGGMEIEKVAEETPDKLLKIQVDPLYGLQGFQAREAAFFLGLEGEQFRNAVTFIIALYNAYMTIDASLAEINPLVVTKEGRVLALDAKINFDGNALFRHKNFL 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_SULDN (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=sucC PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 5.220e-41
Identity = 96/237 (40.51%), Postives = 139/237 (58.65%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRND---AIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  ++ AKYG+  PKGL   SV +     + +       VVK+QI AGGRGLG       GGV + +  EEVE L+ ++LG  LVT QTGP+GK+V K+Y+ E   +  E+Y  ++LDR    P+I+  ++GG +IED+A   P  I+K+ +D   G       ++V GL   + D N+    I    KLYKL+ E+D  ++EINPL +T   + +A D K+ FDD+A  R
Sbjct:    1 MNIHEYQAKQIFAKYGVPTPKGLMAESVKQAVANAETL--GGSIWVVKAQIHAGGRGLG-------GGVKLARSLEEVEQLSKEILGMTLVTHQTGPEGKLVQKLYIEEGADIKEELYLGVVLDRAREMPVIMASTEGGMAIEDVAHNTPEKIIKIAVDPAIGFQGFHGRELVFGLG--ITDPNEQKKLISFASKLYKLYMENDAEMIEINPLVKTGSGEFLALDGKMGFDDSALGR 226          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_EXISA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=sucC PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 6.818e-41
Identity = 96/239 (40.17%), Postives = 139/239 (58.16%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQ  EL+ ++G+ VP G    +V+E   A   +  D +  VVK+QI AGGRG         GGV + K  EEV+  A ++LG+ LVT QTGP+GK+V ++Y+ E  ++  E Y  ++LDR     +I+G S+GG  IE++AE  P  I K  +D   G+    A ++   +       N+  + V KLYK++ E+DCT+ EINPL  T    ++A DAKLNFD NA +R    L
Sbjct:    1 MNIHEYQAKELLREFGVAVPTGYPAFTVEEAVAAAAKL--DGEVKVVKAQIHAGGRGKA-------GGVKLAKTDEEVKQYASEILGKTLVTHQTGPEGKVVQRLYIEEGSAIDQEFYLGLVLDRSIGRIVIMGSSEGGMDIEEVAEHTPEKIHKEIVDPVVGLRPFQARRLAFKMEVPTKLVNEFSDMVMKLYKVYVETDCTIAEINPLVTTKDGNVIALDAKLNFDSNALYRHSDIL 230          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_RHOCS8.054e-4240.68Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BARHE8.054e-4241.35Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BARBK8.054e-4242.62Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACHD1.374e-4141.08Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_CHLT31.794e-4138.17Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_PARDP2.343e-4141.18Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_GEOLS3.997e-4139.92Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_CHLL23.997e-4138.59Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_SULDN5.220e-4140.51Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_EXISA6.818e-4140.17Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top