FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RUBXD (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=sucC PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 5.799e-24
Identity = 68/238 (28.57%), Postives = 131/238 (55.04%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKV--VDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            ++++E+QG EL+ ++G+    G+   + +E ++A + +      + VK+Q+L GGRG         GG+ + +  EE E+ A ++LG  +       +G  V ++ +     +  E+Y + M+DR++  P+I+  ++GG  IE++AE+ P  IV++ +D   G+      ++    GL+ + A   D    V+ LY+ F   D +L+EINPL  T   ++VA DAK+  D+++ +R +
Sbjct:    1 MDLYEHQGKELLGRFGLRTLPGVVATTPEEARRAAERL---GGTVAVKAQVLTGGRGKA-------GGIKVAESPEEAEEAARRILGMDI-------RGHTVRRLLIESGADIERELYLSAMVDRESRRPLILFSTEGGVDIEEVAERSPGSIVRLHVDPLVGLLPYQVRELTFASGLSGETA--KDFGRAVQNLYEAFRGIDASLVEINPLVVTGEGEVVALDAKVTVDNSSLYRHQ 219          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_MYCVP (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=sucC PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 5.799e-24
Identity = 73/242 (30.17%), Postives = 122/242 (50.41%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDG--LAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            +++ EYQ  EL AK+ +    G    S ++ K   +++    K ++VK+Q+  GGRG    K+G  G  +    E+    A  +LG  +       +G IV K+ + E   +  E Y + +LDR     + +   +GG  IE++A   P  + KVP+D   G+ +  A ++ +   L  +V D   A   + KL+++F + D TL+E+NPL  T   Q++A D K+  D NA FRQ  +  F
Sbjct:    1 MDLFEYQAKELFAKHNVPTTPGRVTESAEDAKAIAEEI---GKPVMVKAQVKVGGRG----KAG--GVKYAATPEDALTHAQNILGLDI-------KGHIVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVPVDAVKGVDEAFAREIAEKGHLPAEVLDA--AAVTIAKLWEVFVKEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRQPGHAEF 224          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ARTS2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Arthrobacter sp. (strain FB24) GN=sucC PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 5.799e-24
Identity = 71/240 (29.58%), Postives = 120/240 (50.00%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLL 745
            +++ EYQ  ++   +G+ V  G+   + +E K A + +       VVK+Q+  GGRG         GGV + K  +E  + +  +LG  +       +G  V+KV + +   +  E YF+++LDR     + +   +GG  IE LA + P+ + KV ID   GI    A ++V         R    + + KL+ +F + D TL+E+NPL +T    +VA D K+  D+NA FR  ++ L
Sbjct:    1 MDLFEYQARDMFEAHGVPVLAGIVAHTPEEAKAAAEKI---GGVTVVKAQVKVGGRGKA-------GGVKVAKTADEALEHSTNILGMDI-------KGHTVNKVMIAQGADIAEEYYFSVLLDRANRNYLAMCSVEGGMEIEQLAVERPDALAKVAIDPAVGIDQAKADEIVAAAGFAEELRGKVADVILKLWDVFKKEDATLVEVNPLVKTGAGDIVALDGKVTLDENADFRHAKHAL 223          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACFR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacteroides fragilis GN=sucC PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 7.573e-24
Identity = 74/234 (31.62%), Postives = 114/234 (48.72%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKE-EVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + +HEYQ  E+ + YGI V +     + D    A   +  +   + +K+Q+L GGRG         GGV +   + +V   A  +L   +       +G  V+K+ L E +++  E Y +  +DR T    +I  + GG  IE++A + P  I++  ID   G+ D  A K    L  +    N     ++ LYK F E D +L EINPL  T    L+A DAK+ FDDNA +R
Sbjct:    1 MKVHEYQAKEIFSTYGIPVERHALCHTADGAVAAYHRMGVNR--VAIKAQVLTGGRGKA-------GGVKLANNDRDVYQYAQTILEMTI-------KGYPVTKILLSEAVNIAAEYYISFTIDRNTRSVTLIMSAAGGMDIEEVARQSPEKIIRCSIDPLIGVPDYLAHKFAFSLFEQAEQANRMATIIQDLYKAFIEKDASLAEINPLVLTPVGTLLAIDAKMVFDDNALYR 218          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BACFN (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bacteroides fragilis (strain ATCC 25285 / NCTC 9343) GN=sucC PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 7.573e-24
Identity = 74/234 (31.62%), Postives = 114/234 (48.72%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKE-EVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + +HEYQ  E+ + YGI V +     + D    A   +  +   + +K+Q+L GGRG         GGV +   + +V   A  +L   +       +G  V+K+ L E +++  E Y +  +DR T    +I  + GG  IE++A + P  I++  ID   G+ D  A K    L  +    N     ++ LYK F E D +L EINPL  T    L+A DAK+ FDDNA +R
Sbjct:    1 MKVHEYQAKEIFSTYGIPVERHALCHTADGAVAAYHRMGVNR--VAIKAQVLTGGRGKA-------GGVKLANNDRDVYQYAQTILEMTI-------KGYPVTKILLSEAVNIAAEYYISFTIDRNTRSVTLIMSAAGGMDIEEVARQSPEKIIRCSIDPLIGVPDYLAHKFAFSLFEQAEQANRMATIIQDLYKAFIEKDASLAEINPLVLTPVGTLLAIDAKMVFDDNALYR 218          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_HERA2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=sucC PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 9.891e-24
Identity = 73/235 (31.06%), Postives = 118/235 (50.21%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKEEVEDLAGK-MLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK-LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + +HEYQ  +++A+YGI V  G   A+ +EV+K  + +      + VK+Q+  GGRG         GG+ +         AGK +LG  +       +G  V KV + E ++   E+Y  ++LDR T   ++I  S+GG  IE++A+  P+ I+K+  D   G+    A ++   +    A +      +   LY+ F E+D  L EINPL      QL A D+K+  DD+  FR
Sbjct:    1 MKLHEYQARDIVARYGIPVTGGGVAATAEEVQKVAEQI---GGPVAVKAQVHVGGRGKA-------GGIKLANTPAEAFDAGKAILGMDI-------KGLTVEKVLVAEAITFEKEIYLGVILDRATKRVVLIASSEGGVEIEEVAKINPDAIIKLAADPLLGLQPYQAQELAYSIGITDAKQARQFSSIATGLYRAFVENDAELAEINPLVVLPNGQLQALDSKIVLDDSGLFR 218          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ARTCA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Arthrobacter chlorophenolicus (strain A6 / ATCC 700700 / DSM 12829 / JCM 12360) GN=sucC PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 9.891e-24
Identity = 69/238 (28.99%), Postives = 119/238 (50.00%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRY 739
            +++ EYQ  ++   +G+ V  G+   + +E K A + +       VVK+Q+  GGRG         GGV + K  +E  + +  +LG  +       +G  V+KV + +   +  E YF+++LDR     + +   +GG  IE LA + P  + K+ ID   GI    A ++V         R    + + KL+ +F + D TL+E+NPL +T    +VA D K++ D+NA FR  ++
Sbjct:    1 MDLFEYQARDMFEAHGVPVLAGIVAYTPEEAKAAAEKI---GGVTVVKAQVKVGGRGKA-------GGVKVAKSADEALEHSTNILGMDI-------KGHTVNKVMIAQGADIAEEYYFSVLLDRANRNYLAMCSVEGGMEIEQLAVERPEALAKIAIDPAVGIDQAKADEIVAAAGFAEELRGKVADVILKLWDVFKKEDATLVEVNPLVKTGAGDIVALDGKVSLDENAEFRHAKH 221          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ARTAT (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Arthrobacter aurescens (strain TC1) GN=sucC PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 9.891e-24
Identity = 70/234 (29.91%), Postives = 117/234 (50.00%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +++ EYQ  ++   +G+ V  G+   + +E K A + +       VVK+Q+  GGRG         GGV + K  EE  + +  +LG  +       +G  V+KV + +   +  E YF+++LDR     + +   +GG  IE LA + P  + K+ ID   GI    A ++V         R    + + KL+ +F + D TL+E+NPL  T   ++VA D K++ D+NA FR
Sbjct:    1 MDLFEYQARDMFEAHGVPVLAGIVAHTPEEAKAAAEKI---GGVTVVKAQVKVGGRGKA-------GGVKVAKTAEEALEHSTNILGMDI-------KGHTVNKVMIAQGADIAEEFYFSVLLDRANRNYLAMCSVEGGMEIEQLAVERPEALAKIAIDPAVGIDQAKADEIVAAAGFAEELRGKVADVILKLWDVFKKEDATLVEVNPLVRTGAGEIVALDGKVSLDENADFR 217          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_HALLT (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=sucC PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.292e-23
Identity = 70/235 (29.79%), Postives = 122/235 (51.91%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDV-FPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + +HE+Q   + A  GI VP      +VDE   A  ++ +P      +K+Q+  GGRG         GG+ I   ++E E  A ++LG  L       +G  V ++ + + +  V+E+Y  + +DR    P+++  ++GG +IE++AE+ P+ I +  +D   G+    A KVV           D    +  LY L+ E+D + +E+NP+  TS + ++AADA +N D++A FR
Sbjct:    1 MKLHEHQAKTIFADAGIPVPDSRLATTVDEALDAVDEIGYP----AAIKAQVHVGGRGKA-------GGIKIATDRDEAEQYAEEILGMDL-------KGYTVDQILVEQGVDFVDELYVGVTMDRGEGQPVLMVSTEGGVNIEEVAEENPDAIAREHVDPAFGLHPYQARKVVYEAGVDADVALDVASILTTLYDLYEENDASEIEVNPVMITSDRDVIAADAVMNIDEDALFR 217          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_SALAI (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Salinispora arenicola (strain CNS-205) GN=sucC PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.687e-23
Identity = 75/236 (31.78%), Postives = 119/236 (50.42%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVD--GLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            ++++EYQG +L  ++G+ V  G    + +E +   + +      +VVK+Q+  GGRG         GGV + +  +E    A  +LG  +       +G  V KV +     +  E YF+ +LDR     + I    GG  IE +A + P  +VK PID   G+    A +++   G   +V D+  A+E    L+K F   D TL+E+NPLA T    L+  DAK++ D+NAAFR
Sbjct:    1 MDLYEYQGRDLFERHGLPVLAGGVATTPEEARAIAERL---GGRVVVKAQVKVGGRGKA-------GGVKLAEGADETVARATDILGMDI-------KGHTVHKVMITVTADVAEEYYFSYLLDRANRTFLCIASVAGGMDIEQVAAETPEKVVKAPIDANTGVDAAMARQIITRAGFPAEVVDQ--AVEVAVDLWKAFVAEDATLVEVNPLARTGQGGLLLLDAKVSLDENAAFR 217          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_RUBXD5.799e-2428.57Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_MYCVP5.799e-2430.17Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ARTS25.799e-2429.58Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACFR7.573e-2431.62Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BACFN7.573e-2431.62Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_HERA29.891e-2431.06Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ARTCA9.891e-2428.99Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ARTAT9.891e-2429.91Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_HALLT1.292e-2329.79Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_SALAI1.687e-2331.78Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top