FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_AZOSB (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Azoarcus sp. (strain BH72) GN=sucC PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 6.818e-41
Identity = 97/241 (40.25%), Postives = 137/241 (56.85%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQ  E++ KYG+  P+G+   SVDE  KA +++    K  VVK+QI AGGRG G       GGV + K  +EV  LAG++LG  LVT QTGP+G+ V ++ + E   +  E Y A + DR T    ++  S+GG  IE++A   P  I+KV +D   G+TD  A ++  G+    A    A++  KKLY  + E+D +L EINPL       + A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQAKEVLRKYGVVTPRGIPCFSVDEAVKAAEEL--GGKIWVVKAQIHAGGRGKG-------GGVKLGKSLDEVRTLAGQILGMQLVTHQTGPEGQKVRRLLIEEGADIKKEYYVAALTDRATQKVAMMASSEGGMDIEEVAHNTPEKIIKVFVDPLAGLTDAQAIELAKGIGVPEASIPQAVDTFKKLYTCYMETDASLAEINPLILEGNGNIKALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_HERAR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Herminiimonas arsenicoxydans GN=sucC PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 8.905e-41
Identity = 100/238 (42.02%), Postives = 138/238 (57.98%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQG E++ KYG+  PKG    SVDE  +A + +    K  VVK+QI AGGRG G       GGV + K  +EV   A  +LG  LVT QTGP+G++V ++ + E   +  E+Y  +++DR +    ++  S+GG  IE +AE  P  I KV ID F G+ D +A    D +A K+     +I Q +     LYK F E+D +L EINPL  T   ++VA DAK NFD NA +R
Sbjct:    1 MNIHEYQGKEILRKYGVTTPKGFPCFSVDEAVQAAEKL--GGKVWVVKAQIHAGGRGKG-------GGVKVAKSLDEVRKYANDILGMTLVTHQTGPEGRLVKRLLIEEGADIKKELYVGMVVDRGSQRVALMASSEGGMDIEHVAEHTPEKIHKVFIDPFKGLLDSEA----DDIARKIGVPEGSIPQARAFMQGLYKAFDETDASLAEINPLIVTGDDRIVALDAKFNFDSNALYR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURXL (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia xenovorans (strain LB400) GN=sucC PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 8.905e-41
Identity = 92/241 (38.17%), Postives = 144/241 (59.75%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G  V SVD+  KA +++       VVK+QI AGGRG G       GGV + K  E+V + A ++LG  LVT QTGP+G+ V+++ + E   +  E+Y  +++DR +   +++  S+GG  +E++AEK P +I K+ +D   G+ D +A ++   +    A    A   ++ LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPVFSVDDAVKAAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADIKKELYVGLVIDRVSQKIVVMASSEGGMDVEEVAEKTPELIHKIAVDPATGLKDAEADELATKIGVPAASLPQARAILQGLYKAFWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BARQU (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bartonella quintana GN=sucC PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 8.905e-41
Identity = 96/237 (40.51%), Postives = 137/237 (57.81%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ   L+ +YG  +  G+AV S+++ +K  + +       VVKSQI AGGRG G FK      KGGV + K  EEV     +MLG+ LVTKQTGP+GK V+++Y+ +   +  E+Y ++++DR       +   +GG  IE +AE+ P  I+ +P+D   G+T  D  ++ D L      R D  +    LYK FCE D +LLEINPL       L   DAK++FD+NA FR
Sbjct:    1 MNIHEYQAKRLLHEYGAPIANGVAVYSIEQAEKWAKKL--PGPLYVVKSQIHAGGRGKGKFKELDLDSKGGVRLAKSVEEVVANVKEMLGKTLVTKQTGPEGKQVNRLYIEDGADIERELYLSLLVDRAVGRVAFVVSMEGGMDIETVAEETPEKILTLPVDPVQGVTSADCKRLCDALELHDNARKDGEKLFPILYKAFCEKDMSLLEINPLIVMKDGHLRVLDAKISFDNNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ACICJ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidiphilium cryptum (strain JF-5) GN=sucC PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 8.905e-41
Identity = 96/236 (40.68%), Postives = 139/236 (58.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGL--KGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  EL+  YG+ V  G    + +E  +A + +       VVKSQI AGGRG G FK     KGGV + K  EEV   A  MLG  LVTKQTGP G++V +VY+     +  E+Y ++++DR  +  +I+  ++GG  IE++AEK+P  I++V +D  +GI+   A ++  GL           + V  +YK F   DC ++EINPL  T   ++VA DAK++FDDNA +R
Sbjct:    1 MNIHEYQAKELLKSYGVAVLDGHVAWTGEEAAEAARKL--PGPVYVVKSQIHAGGRGAGHFKDDPEGKGGVRLAKSPEEVAAAAEAMLGNTLVTKQTGPAGRVVRRVYVEAGCDIKRELYLSLLVDRAKSEIVIMASTEGGMEIEEVAEKHPEKILRVAVDPASGISGFHARRLGFGLGLDATQMKAFAKFVNAMYKAFVALDCAIVEINPLVVTGAGEVVALDAKVSFDDNALYR 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURS3 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia sp. (strain 383) GN=sucC PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.163e-40
Identity = 98/245 (40.00%), Postives = 147/245 (60.00%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  +++       VVK+QI AGGRG G       GGV + K  E+V + A ++LG  LVT QTGP+G+ V+++ + E   +  E+Y ++++DR T   +++G S+GG  IE++AEK+P +I KV ++   G+ D  A    D LA K+     +I Q +     LYK F E+D +L EINPL  +S  +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMVEEGADIKQELYVSLVVDRVTQKIVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQA----DDLAAKIGVPAASIPQARAILQGLYKAFWETDASLAEINPLNVSSDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_PELLD (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pelodictyon luteolum (strain DSM 273) GN=sucC PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.519e-40
Identity = 90/241 (37.34%), Postives = 142/241 (58.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFP--DHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG +++ K+G+ VPKG+   S +E K+A + +F   D   +V+K+QI AGGRG         GGV + K  EE  ++A +MLG  LVT QTGP+GK V ++ + E +++  E Y  I LDR T+  +++  ++GG  IE +AE+ P +++K+ +D   G+    A +    L  +     +A+  +  LY  +   D  L EINPL  T   +++A DAK+NFD NA +R K ++
Sbjct:    1 MNIHEYQGKDILRKFGVAVPKGIVAYSAEEAKQAAEQLFAEQDSPVVVIKAQIHAGGRGKA-------GGVKLAKSPEEAHEIASQMLGTTLVTHQTGPEGKEVRRLLVEEGMNIDREFYVGITLDRATSNNVLMISTEGGMEIEKVAEETPELLLKIQVDARFGLQGFQAREAAFFLGLEGEQFRNAVSFITALYNAYTSIDAALAEINPLVVTKEGRVLALDAKINFDSNALYRHKDFI 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_NAUPA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=sucC PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.519e-40
Identity = 91/234 (38.89%), Postives = 139/234 (59.40%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E+  KYG+  P+G    +  E ++  +++       VVK+QI AGGRG         GGV + K  +EVE +A +MLG  LVT QTGP+GK+V KVY+ E   + +E+Y  ++LDR    P+++  ++GG  IE++AEK P  I+KV ID   G     A K+  GL     ++ + I+    LY ++ ++D  ++EINPL +T   + +A DAK+ FDDNA ++
Sbjct:    1 MNIHEYQAKEIFRKYGVPTPRGGVAFTGPEARRVAEEL--GGNLWVVKAQIHAGGRGKA-------GGVKLAKSLDEVEKIAEEMLGMTLVTHQTGPEGKVVKKVYIEEGADIKDELYLGMVLDRALEMPVMMASTEGGMEIEEVAEKTPEKIIKVAIDPAIGFQPFHARKLAFGLGLPKDEQREFIKFASALYNVYMDNDAEMIEINPLIKTGDGKFLALDAKMGFDDNALYK 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_PROVI (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Prosthecochloris vibrioformis (strain DSM 265) (strain DSM 265) GN=sucC PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.984e-40
Identity = 91/241 (37.76%), Postives = 142/241 (58.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKE--LVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG +++ K+G+ VPKG+   S +E K+A + +F +     +VVK+QI AGGRG         GGV + K  EE  ++A +M+G  LVT QTGP+GK V ++ + E +++  E Y  I LDR T+  +++  ++GG  IE +AE+ P+ ++K+ +D   G+    A +    L  +      A+  +  LYK +   D  L EINPL  T   +++A DAK+NFD NA +R K +L
Sbjct:    1 MNIHEYQGKDILRKFGVAVPKGIVAHSPEEAKQAAEQLFEEQSSPVVVVKAQIHAGGRGKA-------GGVKLAKSPEEAYEIASQMIGTTLVTHQTGPEGKEVRRLLVEEGMNIDREFYVGITLDRATSQNVLMISTEGGMEIEKVAEETPDRLLKIQVDPLFGLQGFQAREAAFFLGLEGEQFRSAVSFIMSLYKAYTSIDAALAEINPLVVTKEGRVLALDAKINFDSNALYRHKDFL 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ACIC5 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670) GN=sucC PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.984e-40
Identity = 96/237 (40.51%), Postives = 137/237 (57.81%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDH-KELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            + IHEYQ  +++AKYG+ VP+G    +++E     + +F +  K +VVK+QI AGGRG G       GGV + K  EE E  A ++LG  LVT QTGPQG+ V ++ + E  ++  E+Y  I+LDR  A  + +    GG  IE++A K P+ I K  ID   G     A ++   L  K    NDA++ +  LYK + ++D +LLEINP   T   +L A D K+NFDDNA FR K
Sbjct:    1 MKIHEYQAKDILAKYGVAVPRGEVANTLEEAMDVAKRLFAEGAKGVVVKAQIHAGGRGKG-------GGVKVAKTLEEAEQYAKQILGMQLVTHQTGPQGQKVQRLLIEETAAIDRELYLGIVLDRAAAKLVFMASQAGGMEIEEVAAKDPSAIFKAYIDPAVGFQAYQARQLAFALGLKPTQINDAVKFMMGLYKAYMDTDASLLEINPFITTKDDKLFALDCKINFDDNAMFRHK 230          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_AZOSB6.818e-4140.25Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_HERAR8.905e-4142.02Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURXL8.905e-4138.17Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BARQU8.905e-4140.51Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ACICJ8.905e-4140.68Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURS31.163e-4040.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_PELLD1.519e-4037.34Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_NAUPA1.519e-4038.89Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_PROVI1.984e-4037.76Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ACIC51.984e-4040.51Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top