FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BORA1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Bordetella avium (strain 197N) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.772e-40
Identity = 93/241 (38.59%), Postives = 138/241 (57.26%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG EL+ ++G+ VP+G+   SV+E   A + +       VVK+QI AGGRG G       GGV + +  +EV  LA ++LG  LVT QTG QG+ V+++Y+ +   +  E Y +++ DR T    +I  S+GG  IE++A   P  I+   ID   G+TD  A KV D +         A++  KKLY+ + ++D +L+EINPL   S   ++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKELLKQFGVPVPRGIPAFSVEEAVAAAEKL--GGPVWVVKAQIHAGGRGKG-------GGVKLARSLDEVRQLASQILGMQLVTHQTGAQGQKVNRLYIEDGADIQKEYYVSLVTDRGTQKVALIASSEGGMDIEEVAHSTPEKIITEYIDPIVGLTDAQAKKVADAIGMPADSTAQAVDVFKKLYQCYMDTDASLVEINPLNRDSKGNIIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOSK (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.538e-40
Identity = 96/238 (40.34%), Postives = 135/238 (56.72%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKKE-EVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            +NIHEYQ   L+  YG  V  G  V   DE K A  ++       VVK+QI AGGRG G FK   +G KGGV + K   E  +LA +MLG+ LVT QTGP GK V+++Y+ E   +  E+Y A+++DR T+    +  ++GG  IE++A   P  IV   +D  +G++D    +V   L  + A     ++ VK LY+ F E D  +LEINPL   +   L   DAK+ FD+NA +RQ
Sbjct:    1 MNIHEYQAKALLRSYGAPVSDGRVVLKADEAKSAAGEL--GGPLWVVKAQIHAGGRGKGKFKEPEAGEKGGVRLAKSVGEAAELAKQMLGRTLVTHQTGPAGKQVNRIYIEEGSDIARELYLALLVDRGTSRISFVVSTEGGMDIEEVAASTPEKIVSFSVDPASGLSDFHGRRVAFALGLEGAQVKQCVQLVKNLYRAFVEKDMEMLEINPLIVMTDGNLKVLDAKVGFDNNALYRQ 236          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOS4 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.538e-40
Identity = 96/238 (40.34%), Postives = 135/238 (56.72%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKKE-EVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            +NIHEYQ   L+  YG  V  G  V   DE K A  ++       VVK+QI AGGRG G FK   +G KGGV + K   E  +LA +MLG+ LVT QTGP GK V+++Y+ E   +  E+Y A+++DR T+    +  ++GG  IE++A   P  IV   +D  +G++D    +V   L  + A     ++ VK LY+ F E D  +LEINPL   +   L   DAK+ FD+NA +RQ
Sbjct:    1 MNIHEYQAKALLRSYGAPVSDGRVVLKADEAKSAAGEL--GGPLWVVKAQIHAGGRGKGKFKEPEAGEKGGVRLAKSVGEAAELAKQMLGRTLVTHQTGPAGKQVNRIYIEEGSDIARELYLALLVDRGTSRISFVVSTEGGMDIEEVAASTPEKIVSFSVDPASGLSDFHGRRVAFALGLEGAQVKQCVQLVKNLYRAFVEKDMEMLEINPLIVMTDGNLKVLDAKVGFDNNALYRQ 236          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHOS1 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.538e-40
Identity = 96/238 (40.34%), Postives = 135/238 (56.72%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIVKKE-EVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            +NIHEYQ   L+  YG  V  G  V   DE K A  ++       VVK+QI AGGRG G FK   +G KGGV + K   E  +LA +MLG+ LVT QTGP GK V+++Y+ E   +  E+Y A+++DR T+    +  ++GG  IE++A   P  IV   +D  +G++D    +V   L  + A     ++ VK LY+ F E D  +LEINPL   +   L   DAK+ FD+NA +RQ
Sbjct:    1 MNIHEYQAKALLRSYGAPVSDGRVVLKADEAKSAAGEL--GGPLWVVKAQIHAGGRGKGKFKEPEAGEKGGVRLAKSVGEAAELAKQMLGRTLVTHQTGPAGKQVNRIYIEEGSDIARELYLALLVDRGTSRISFVVSTEGGMDIEEVAASTPEKIVSFSVDPASGLSDFHGRRVAFALGLEGAQVKQCVQLVKNLYRAFVEKDMEMLEINPLIVMTDGNLKVLDAKVGFDNNALYRQ 236          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_JANMA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Janthinobacterium sp. (strain Marseille) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.538e-40
Identity = 99/238 (41.60%), Postives = 137/238 (57.56%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQG E++ KYG+  PKG    SVDE  +A + +    K  VVK+QI AGGRG G       GGV + K  +EV   A  +LG  LVT QTGP+G++V ++ + E   +  E+Y  +++DR +    ++  S+GG  IE +AE  P  I KV ID   G+ D +A    D +A K+     +I Q +     LYK F E+D +L EINPL  T   ++VA DAK NFD NA +R
Sbjct:    1 MNIHEYQGKEILRKYGVTTPKGFPCFSVDEAVQAAEKL--GGKVWVVKAQIHAGGRGKG-------GGVKVAKSLDEVRKYANDILGMTLVTHQTGPEGRLVKRLLIEEGADIKKELYVGMVVDRGSQRVALMASSEGGMDIEHVAEHTPEKIHKVFIDPVKGLLDSEA----DDIARKIGVPEGSIGQARAFMQGLYKAFDETDASLAEINPLIVTGDDRIVALDAKFNFDSNAMYR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_DECAR (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Dechloromonas aromatica (strain RCB) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.538e-40
Identity = 94/235 (40.00%), Postives = 135/235 (57.45%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            + IHEYQG +++ K+G+ VP+G+   +V++  KA + +    K  VVK+QI AGGRG G       GGV +    E+V + AG++LG  LVT QTGP+G+ V  + + E   + +E Y A + DR T    I+   +GG  IE++A K P  IVKV ++   G+TDE A  +  G+    A     IE +K LY  + E+D +L EINPL       + A DAK NFD NA +RQ
Sbjct:    1 MKIHEYQGKQILKKFGVTVPRGIHCTTVEDAVKAAETL--GGKVWVVKAQIHAGGRGKG-------GGVKVATSLEKVREYAGQILGMQLVTHQTGPEGQKVRHLLIEEGADIKHEYYVAALTDRATQSVAIMASYEGGMDIEEVAHKTPEKIVKVFVNPLVGLTDEQALTLAKGMGMNEASIPQCIETLKSLYTCYMETDASLAEINPLIHEGDGTVKALDAKFNFDSNALYRQ 226          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURPP (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.538e-40
Identity = 90/241 (37.34%), Postives = 144/241 (59.75%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G  V SVD+  KA +++       VVK+QI AGGRG G       GGV + K  ++V + + ++LG  LVT QTGP+G+ V+++ + E   +  E+Y  +++DR +   +++  S+GG  +E++AEK P +I K+ +D   G+ D +A ++   +    A    A   ++ LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPVFSVDDAVKAAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLDQVREYSEQILGMQLVTHQTGPEGQKVNRLLIEEGADIKKELYVGLVIDRVSQKIVVMASSEGGMDVEEVAEKTPELIHKIAVDPATGLKDAEADELATKIGVPAASLPQARAILQGLYKAFWETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ALKOO (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alkaliphilus oremlandii (strain OhILAs) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.538e-40
Identity = 95/239 (39.75%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQ  EL+  YG+ VP+G  +  V + ++A   +  D    VVK+QI AGGRG         GGV I K   EVE  + ++LG+ LVT QTG +G++V  + + E   +  E Y A  LDR+ +   +I   +GG  IE++A   P+ I+K  ID   G+TD    +V   L    +  ND +E +K LY+ F E DC+LLEINPL  T   +++A DAK+NFD N  +R +  L
Sbjct:    1 MNIHEYQAKELLRDYGVPVPRGQVIYDVRDAQRAAWHIESDIA--VVKAQIHAGGRGKA-------GGVKIAKSITEVEQFSRELLGKTLVTHQTGQEGRVVKAILIEEGCEIYKEYYIAFTLDRENSKIALIASEEGGMDIEEVAANRPDKILKEIIDPLIGLTDFQGRRVCFNLNIDGSLINDTVELMKNLYRCFIEKDCSLLEINPLVITKNNRVMALDAKINFDGNGLYRNEDVL 230          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ALKMQ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Alkaliphilus metalliredigens (strain QYMF) GN=sucC PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.538e-40
Identity = 93/241 (38.59%), Postives = 142/241 (58.92%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            +NIHEYQG E+M +YGI+VP+     +V+E  +A  D+    + + VK+QI AGGRG         GGV I +  EE +  A  +L +IL+TKQTGP+GK+V++V + E L +  E Y +  +D  T+  ++IG  +GG  IE++AEK P+ I K  ID   G+    A ++   +    A   +A + +  +Y+LF E DC+++EINPL  T   ++VA D K+ FDDN+  R    L +
Sbjct:    1 MNIHEYQGKEIMKQYGISVPRSRITFTVEEAVQAAIDL--GCEVIAVKAQIHAGGRGKA-------GGVKITRSLEETKSAAEAILDKILITKQTGPEGKVVNQVLIEEGLKIEKECYLSCAVDSTTSTVVLIGSPEGGMDIEEVAEKTPHKIFKESIDPAIGLQQYQARRLAFNMGINEACLQEAAQCIMNIYRLFMEKDCSMVEINPLITTEEHKVVALDCKVCFDDNSLCRHPEILKY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURCM (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=sucC PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 9.845e-40
Identity = 96/245 (39.18%), Postives = 146/245 (59.59%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  +++       VVK+QI AGGRG G       GGV + K  E+V + A ++LG  LVT QTGP+G+ V+++ + E   +  E+Y ++++DR +   +++G S+GG  IE++AEK+P +I KV ++   G+ D  A    D LA K+     +I Q +     LYK F E+D +L EINPL  +   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRISQKIVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQA----DDLAAKIGVPAASIPQARAILQGLYKAFWETDASLAEINPLNVSGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_BORA15.772e-4038.59Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHOSK7.538e-4040.34Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHOS47.538e-4040.34Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHOS17.538e-4040.34Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_JANMA7.538e-4041.60Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_DECAR7.538e-4040.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURPP7.538e-4037.34Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ALKOO7.538e-4039.75Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ALKMQ7.538e-4038.59Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURCM9.845e-4039.18Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top