FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURA4 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia ambifaria (strain MC40-6) GN=sucC PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 9.845e-40
Identity = 96/245 (39.18%), Postives = 146/245 (59.59%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  +++       VVK+QI AGGRG G       GGV + K  E+V + A ++LG  LVT QTGP+G+ V+++ + E   +  E+Y ++++DR +   +++G S+GG  IE++AEK+P +I KV ++   G+ D  A    D LA K+     +I Q +     LYK F E+D +L EINPL  +   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRISQKIVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQA----DDLAAKIGVPAASIPQARAILQGLYKAFWETDASLAEINPLNVSGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_PROA2 (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=sucC PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.286e-39
Identity = 89/241 (36.93%), Postives = 145/241 (60.17%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKE--LVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYL 742
            +NIHEYQG +++ K+G++VPKG+   + +E ++A + +F + +   +VVK+QI AGGRG         GGV + K  +EV D+A +M+G  LVT QTGP+GK V ++ + E +++  E Y  I LDR T+  +++  ++GG  IE +AE+ P  ++K+ I    G+    A +    L  +     + ++ +  LYK +   D ++ EINPL  T   +++A DAK+NFD NA FR K +L
Sbjct:    1 MNIHEYQGKDILRKFGVSVPKGIVAFTAEEARQAAEQLFEEQENPVVVVKAQIHAGGRGKA-------GGVKLAKSPDEVFDIARQMIGCTLVTHQTGPEGKEVRRLLVEEGMNIEKEFYVGITLDRATSQNVLMVSTEGGMEIETVAEETPEKLLKIQIHPLQGLQGFQARQAAFFLGLEGDKFKNTVKFITALYKAYTAIDASIAEINPLVITKEGKVMALDAKINFDSNALFRHKDFL 234          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RICTY (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rickettsia typhi GN=sucC PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.679e-39
Identity = 95/234 (40.60%), Postives = 132/234 (56.41%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVK-KEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHEYQ  E++ KYG+    GL V   +++ +A   +  + K  VVK+QI AGGRG         GGV +VK KEE + +A  M G  LVT QTGPQG+ V+ +Y+     ++ E YF+I+ DR  +    I  ++GG  IE +AEK P  I+K  +D   G+ D     +  GL  K +      E VK +Y  F E+D T +EINPL   S K L+A DAK+ FDDN  F+
Sbjct:    1 MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINEAIDKL--NTKVYVVKAQIHAGGRGKA-------GGVKVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNHLYIESGCDILKEYYFSIVFDRSASCITFIASTEGGVDIEAVAEKMPEKIIKFAVDPATGLQDFHMRGIAYGLGFKDSQAKQMKEIVKSVYNAFIETDATQIEINPLIINSYKNLLALDAKITFDDNGLFK 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_MARMM (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Maricaulis maris (strain MCS10) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.679e-39
Identity = 97/237 (40.93%), Postives = 137/237 (57.81%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFK---SGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            +NIHE+Q   ++  +G  V +G+A+ S DE   A  D  P     VVKSQI AGGRG G FK   S  KGGV +   KE+V   A +MLG  LVT QTGP+GK V+++Y+ +   +  E+Y +++++R+T     +  ++GG  IE++A + P  I  + ID   G+TD  AA V D L  +   R D +   K LY  FCE D ++LEINPL       +   DAK++FD NA FR
Sbjct:    1 MNIHEHQAKAVLKSFGAPVAEGVAIFSADEAAAAA-DQLPGPL-WVVKSQIHAGGRGKGKFKELGSDAKGGVRLAFSKEDVVKNAKEMLGNTLVTHQTGPEGKRVNRLYIEDGADIATELYCSLLVNRETGQVAFVVSTEGGMDIEEVAAETPEKIQTIDIDPSTGVTDASAAAVCDALKLEGQAREDMMGLAKILYTAFCEKDMSMLEINPLIVMDNGHVRVLDAKVSFDGNALFR 235          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURCJ (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.679e-39
Identity = 96/245 (39.18%), Postives = 145/245 (59.18%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  +++       VVK+QI AGGRG G       GGV + K  E+V + A ++LG  LVT QTGP+G+ V+++ + E   +  E+Y ++++DR +   +++G S+GG  IE++AEK+P +I KV ++   G+ D  A    D LA K+     +I Q +     LYK F E+D +L EINPL  +   ++ A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRVSQKIVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQA----DDLAAKIGVPAASIPQARAILQGLYKAFWETDASLAEINPLNVSGDGKVTALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_ACIAC (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Acidovorax avenae subsp. citrulli (strain AAC00-1) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.679e-39
Identity = 94/234 (40.17%), Postives = 137/234 (58.55%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            + IHEYQG E++  +G+ VP+G+   +V E  +A Q +       VVK+QI AGGRG G       GGV + K  ++V+ LAG +LG  L T QTGP+G+ V ++Y+ +   + NE+Y +++ DR T    +I  S+GG  IE++A   P+ IV   ID   GIT E   KV + +       + A++   KLYK + ++D +L+EINPL   S   L+A DAK NFD NA FR
Sbjct:    1 MKIHEYQGKEILRSFGVPVPRGIPAFTVQEAVEAAQKL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSIDDVKKLAGDILGMQLKTHQTGPEGQKVRRLYIEDGADIKNELYVSLVTDRATQKVALIASSEGGMDIEEVAHSTPDKIVTEMIDPLTGITPEQGRKVAEAIGLSGKSVDQALDIFAKLYKCYMDTDASLVEINPLNCDSKGDLMALDAKFNFDANALFR 225          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_RHIME (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Rhizobium meliloti GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 99/239 (41.42%), Postives = 136/239 (56.90%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKS---GLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +NIHEYQ   L+  YG  V +G+A+ S DE + A + +       VVKSQI AGGRG G FK      KGGV + K  +EV   A  MLG  LVTKQTGP GK V+++Y+ +   +  E+Y +I++DR       +  ++GG  IE +AE  P  IV V ID   G+T E+   + D L  +   R DA +    LYK F E D +LLE+NPL   +  ++   DAK++FD NA FR +
Sbjct:    1 MNIHEYQAKALLKSYGAPVAEGVAIFSADEAEAAAKKL--PGPLYVVKSQIHAGGRGKGKFKELGPDAKGGVRLAKSVDEVVANAKDMLGNTLVTKQTGPAGKQVNRLYIEDGADIDRELYLSILVDRSVGQVAFVVSTEGGMDIEAVAEHTPEKIVTVAIDPEKGVTAENLKTLADALKLEGEARADAEKLFPILYKAFVEKDMSLLEVNPLIVMTNGRMRVLDAKVSFDGNALFRHE 237          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURVG (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 96/245 (39.18%), Postives = 145/245 (59.18%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKK----LYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  +++       VVK+QI AGGRG G       GGV + K  E+V + A ++LG  LVT QTGP+G+ V+++ + E   +  E+Y ++++DR +   +++G S+GG  IE++AEK+P +I KV ++   G+ D  A    D LA K+     +I Q +     LYK F E+D +L EINPL  +   ++ A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKTIEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADIKQELYVSLVVDRVSQKIVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQA----DDLAAKIGVPAASIPQARTILQGLYKAFWETDASLAEINPLNVSGDGKVTALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURTA (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 93/241 (38.59%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  +++       VVK+QI AGGRG G       GGV + K  ++V + A ++LG  L T QTGP+G+ V+++ + E   +  E+Y  I++DR +   +++  S+GG  IE++AEK P  I KV ++   G+ D +A  +   +    A    A E +K LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLDQVREYANQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQKVVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSTGLQDAEADDLAKKIGVPDASIPQAREILKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCC_BURPS (Succinyl-CoA ligase [ADP-forming] subunit beta OS=Burkholderia pseudomallei GN=sucC PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.193e-39
Identity = 94/241 (39.00%), Postives = 140/241 (58.09%), Query Frame = 2
Query:   29 LNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKRYLLF 748
            + IHEYQG E++ K+G+ VP+G    SVDE  K  Q++       VVK+QI AGGRG G       GGV + K  E+V + + ++LG  L T QTGP+G+ V+++ + E   +  E+Y  I++DR +   +++  S+GG  IE++AEK P  I KV ++   G+ D +A  +   +    A    A E +K LYK F E+D +L EINPL  T   +++A DAK NFD NA FR    + +
Sbjct:    1 MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQEL--GGPVWVVKAQIHAGGRGKG-------GGVKVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQKVVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREILKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAY 232          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCC_BURA49.845e-4039.18Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_PROA21.286e-3936.93Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RICTY1.679e-3940.60Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_MARMM1.679e-3940.93Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURCJ1.679e-3939.18Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_ACIAC1.679e-3940.17Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_RHIME2.193e-3941.42Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURVG2.193e-3939.18Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURTA2.193e-3938.59Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]
SUCC_BURPS2.193e-3939.00Succinyl-CoA ligase [ADP-forming] subunit beta OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top