FC875594

Overview
NameFC875594
Unique NameFC875594
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length688
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:5..692. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_RHOPT (Adenosylhomocysteinase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 9.234e-47
Identity = 90/147 (61.22%), Postives = 107/147 (72.79%), Query Frame = 2
Query:  146 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 586
            +A   ++ VKD+  A+FGR EI LAE EMPGLMA R E+GP QP KGAKI GSLHMTIQTAVLIETL ALGAEVRW SCNI+STQDH               KGETL++YW  T K  DW  GG P++I+DDGGDAT+ +H+G++AE
Sbjct:    2 TAKFTDYIVKDIGLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGAKIAGSLHMTIQTAVLIETLVALGAEVRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLKDYWDYTAKLFDWSDGGTPNMILDDGGDATMFVHQGLRAE 148          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_RHOPA (Adenosylhomocysteinase OS=Rhodopseudomonas palustris GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 9.234e-47
Identity = 90/147 (61.22%), Postives = 107/147 (72.79%), Query Frame = 2
Query:  146 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 586
            +A   ++ VKD+  A+FGR EI LAE EMPGLMA R E+GP QP KGAKI GSLHMTIQTAVLIETL ALGAEVRW SCNI+STQDH               KGETL++YW  T K  DW  GG P++I+DDGGDAT+ +H+G++AE
Sbjct:    2 TAKFTDYIVKDIGLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGAKIAGSLHMTIQTAVLIETLVALGAEVRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLKDYWDYTAKLFDWSDGGTPNMILDDGGDATMFVHQGLRAE 148          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_MYCPA (Adenosylhomocysteinase OS=Mycobacterium paratuberculosis GN=ahcY PE=3 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 9.234e-47
Identity = 99/193 (51.30%), Postives = 123/193 (63.73%), Query Frame = 2
Query:  152 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH---------XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDW-----GPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            +G EFKV DLS AD+GR +IEL+E EMPGLM+ R E+   QP KGA+I+GSLHMT+QTAVLIETL ALGAEVRW SCNIFSTQDH                       WKGETL+EYWW  E+AL W     G     ++I+DDGGDAT+L+  G +    YEK G +P     D+AE ++ L ++R   + D
Sbjct:   14 NGIEFKVADLSLADYGRRDIELSEQEMPGLMSLRREYHDVQPLKGARISGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAVVVGPHGTPEEPRGVPVFAWKGETLEEYWWAAEQALTWPPLADGTEAPANMILDDGGDATMLVLRGAQ----YEKAGVVPPDDEDDSAEHRVFLNLLRARFETD 202          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_PELLD (Adenosylhomocysteinase OS=Pelodictyon luteolum (strain DSM 273) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.583e-46
Identity = 88/146 (60.27%), Postives = 107/146 (73.29%), Query Frame = 2
Query:  149 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 586
            A+   +KV D+S A++GR EI++AE EMPGLMA R ++   +P KGA++ GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGETL++YWWCT + LD+G G GP+LIVDDGGDATL+I  G K E
Sbjct:    5 ATALAYKVADISLAEWGRKEIDIAEKEMPGLMAIRKKYAGQKPLKGARVAGSLHMTIQTAVLIETLVDLGADVRWASCNIFSTQDHAAAAIAATGVPVFAWKGETLEDYWWCTRQILDFGDGQGPNLIVDDGGDATLMIILGYKIE 150          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_PELCD (Adenosylhomocysteinase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.583e-46
Identity = 98/175 (56.00%), Postives = 119/175 (68.00%), Query Frame = 2
Query:  164 FKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            + VKD+  A++GR EI +AE EMPGLMA R E+  ++P  GA+ITGSLHMTIQTAVLIETL  LGA++RW SCNI+STQDH              +KGETL+EYW  T KAL +    GP LIVDDGGDATLLIH GV+ E  Y +TGK+P+  S DN E  IV  ++   L  D
Sbjct:   10 YVVKDMGLAEWGRREIRMAEAEMPGLMAIREEYRGTKPLAGARITGSLHMTIQTAVLIETLAELGADLRWASCNIYSTQDHAAAAIAATGVPVFAYKGETLEEYWEYTFKALAYEE--GPQLIVDDGGDATLLIHRGVERERAYARTGKVPE-ISHDNKELSIVDALLNRQLLVD 181          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_PELPB (Adenosylhomocysteinase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.985e-46
Identity = 92/152 (60.53%), Postives = 107/152 (70.39%), Query Frame = 2
Query:  161 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLP 616
            ++KV DLS A++GR EI++AE EMPGLMA R ++    P KGA+I GSLHMTIQTAVLIETL  LGAEVRW SCNIFSTQDH              WKGETL+EYWWCT + L++  G GP+LIVDDGGDATL+I  G K E   E   K P
Sbjct:    9 DYKVADLSLAEWGRKEIDVAEKEMPGLMATRRKYAGQYPLKGARIAGSLHMTIQTAVLIETLVELGAEVRWASCNIFSTQDHAAAAIAKSGVPVFAWKGETLEEYWWCTRQILEFEGGKGPNLIVDDGGDATLMIILGYKIENNPELLEKAP 160          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_DESVM (Adenosylhomocysteinase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.985e-46
Identity = 91/165 (55.15%), Postives = 115/165 (69.70%), Query Frame = 2
Query:  167 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 658
            KV D++ ADFG  E++L+E E+PGLM     +G S+P KG ++TGSLHMTIQTA+LI+TL  LGA++RW SCNIFSTQDH               WKGETL++YWWCTE AL W  G GPDL+VDDGGDATL+IH+GV+ E   E   +     + DN EFQI++
Sbjct:   17 KVADMALADFGHKEMQLSEREVPGLMELIRMYGVSKPLKGLRVTGSLHMTIQTAMLIKTLYELGADIRWASCNIFSTQDHAAAAIADSGMAKVFAWKGETLEDYWWCTEMALTWPDGSGPDLLVDDGGDATLMIHKGVEVENNPELLKQ-----AYDNKEFQIIM 176          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_BRASB (Adenosylhomocysteinase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.985e-46
Identity = 94/166 (56.63%), Postives = 113/166 (68.07%), Query Frame = 2
Query:  161 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 658
            ++ VKD+S A+FGR EI LAE EMPGLMA R E+GP QP KGA+I GSLHMTIQTAVLIETL ALGA++RW SCNI+STQDH               KGETL +YW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  PAS +   F  +L
Sbjct:    9 DYIVKDISLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGARIAGSLHMTIQTAVLIETLAALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLADYWDYTAKLFDWHGGGHPNMILDDGGDATMYVHLGLRAEN--GDTAFLDKPASEEEEVFFALL 172          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_BRAJA (Adenosylhomocysteinase OS=Bradyrhizobium japonicum GN=ahcY PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 5.985e-46
Identity = 94/166 (56.63%), Postives = 111/166 (66.87%), Query Frame = 2
Query:  161 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL 658
            ++ VKD+S ADFGR E+ LAE EMPGLMA R EFGP QP KGA+I GSLHMTIQT VLIETL ALGA++RW SCNI+STQDH               KGETL EYW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    9 DYIVKDISLADFGRKELSLAETEMPGLMATREEFGPKQPLKGARIAGSLHMTIQTGVLIETLAALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTAKLFDWHGGGHPNMILDDGGDATMYVHLGLRAEN--GDTAFLDKPGSEEEEVFFALL 172          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_CHLTE (Adenosylhomocysteinase OS=Chlorobium tepidum GN=ahcY PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.021e-45
Identity = 91/155 (58.71%), Postives = 107/155 (69.03%), Query Frame = 2
Query:  161 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA 625
            ++KV D+S A++GR EIE+AE EMPGLMA R ++   +P  GA+I GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGETL EYWWCT + L++  G GP+LIVDDGGDATL+IH G K E       K P  A
Sbjct:    9 DYKVADISLAEWGRKEIEIAEKEMPGLMATRKKYEGKKPLAGARIAGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAIAAAGVPVFAWKGETLDEYWWCTRQILEFEGGLGPNLIVDDGGDATLMIHFGYKIENDPSMLDKTPGNA 163          
The following BLAST results are available for this feature:
BLAST of FC875594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_RHOPT9.234e-4761.22Adenosylhomocysteinase OS=Rhodopseudomonas palustr... [more]
SAHH_RHOPA9.234e-4761.22Adenosylhomocysteinase OS=Rhodopseudomonas palustr... [more]
SAHH_MYCPA9.234e-4751.30Adenosylhomocysteinase OS=Mycobacterium paratuberc... [more]
SAHH_PELLD4.583e-4660.27Adenosylhomocysteinase OS=Pelodictyon luteolum (st... [more]
SAHH_PELCD4.583e-4656.00Adenosylhomocysteinase OS=Pelobacter carbinolicus ... [more]
SAHH_PELPB5.985e-4660.53Adenosylhomocysteinase OS=Pelodictyon phaeoclathra... [more]
SAHH_DESVM5.985e-4655.15Adenosylhomocysteinase OS=Desulfovibrio vulgaris (... [more]
SAHH_BRASB5.985e-4656.63Adenosylhomocysteinase OS=Bradyrhizobium sp. (stra... [more]
SAHH_BRAJA5.985e-4656.63Adenosylhomocysteinase OS=Bradyrhizobium japonicum... [more]
SAHH_CHLTE1.021e-4558.71Adenosylhomocysteinase OS=Chlorobium tepidum GN=ah... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F08EF CTVClemen1 Citrus clementina cDNA clone C31405F08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875594 ID=FC875594|Name=FC875594|organism=Citrus clementina|type=EST|length=688bp
GCTCACCCCACTCTATCTCTCTCGCTTGTACAATCATTCACTTTGTTTGG
TTGGTTTCCAAAGAGAGAGTAGAGTGCCCTCTCTTCCTTCTTCCTTTTAG
ATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAATCCGC
TAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTTCGGCC
GCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGGCTTGC
CGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATCACCGG
TTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCTCACCG
CTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAACCCAA
GACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTTGCCTG
GAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGCCCTGG
ACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTGGTGAC
GCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTACGAGAA
GACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGTTTCAGA
TTGTTTTGACTATCATTAGAGATGGGTTGAAGGCCGAT
back to top