FC875607

Overview
NameFC875607
Unique NameFC875607
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length456
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3817 contig Ccv1_Contig3817:1..456. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: ISU1_SCHPO (Iron sulfur cluster assembly protein 1, mitochondrial OS=Schizosaccharomyces pombe GN=isu1 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.405e-22
Identity = 53/78 (67.95%), Postives = 59/78 (75.64%), Query Frame = 1
Query:   13 GQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRTKP 246
            G I D  FKTFGCGSAIASSS  T  VKG  ++E   IKNT+IAK L LPPVKLHCSMLAEDAIK+AVK Y +K+  P
Sbjct:  102 GVIEDVKFKTFGCGSAIASSSYVTTMVKGMTLEEASKIKNTQIAKELCLPPVKLHCSMLAEDAIKSAVKHYRSKQLTP 179          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_AZOVI (Nitrogen fixation protein nifU OS=Azotobacter vinelandii GN=nifU PE=3 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 1.152e-16
Identity = 43/79 (54.43%), Postives = 56/79 (70.89%), Query Frame = 1
Query:    1 DEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDYEAK 234
            D ET  I+DA F+TFGCGSAIASSS  TE VKG  + E L I N +IA +L  LPP K+HCS++  +A++AAV +Y  +
Sbjct:   46 DPETDVILDAGFQTFGCGSAIASSSALTEMVKGLTLDEALKISNQDIADYLDGLPPEKMHCSVMGREALQAAVANYRGE 124          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_AZOCH (Nitrogen fixation protein nifU OS=Azotobacter chroococcum mcd 1 GN=nifU PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.078e-14
Identity = 40/82 (48.78%), Postives = 54/82 (65.85%), Query Frame = 1
Query:    1 DEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLS-LPPVKLHCSMLAEDAIKAAVKDYEAKRTK 243
            D ET  I+DA F+TFGCGSAIASSS  TE VKG  + + L I N +IA  L  LP  K+HCS++  + ++AAV +Y  +  +
Sbjct:   46 DPETDVILDAGFQTFGCGSAIASSSALTEMVKGADLDDALKISNRDIAHFLGRLPREKMHCSVMGRERLQAAVANYRGEELR 127          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_ANASP (Nitrogen fixation protein nifU OS=Anabaena sp. (strain PCC 7120) GN=nifU PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.098e-14
Identity = 40/88 (45.45%), Postives = 60/88 (68.18%), Query Frame = 1
Query:    7 ETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDYEAKRTKPSAASEAE 267
            E+ +IVD+ F+TFGC SAIASSS  TE +KG  + E L + N +IA +L  LP  K+HCS++ ++A++AA+ +Y   R  P AA + +
Sbjct:   54 ESDKIVDSRFQTFGCTSAIASSSALTEMIKGLTLDEALKVSNKDIADYLGGLPEAKMHCSVMGQEALEAAIYNY---RGIPLAAHDED 138          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_ANAAZ (Nitrogen fixation protein nifU OS=Anabaena azollae GN=nifU PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 5.352e-14
Identity = 36/74 (48.65%), Postives = 54/74 (72.97%), Query Frame = 1
Query:    7 ETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDY 225
            E+ +IVD+ F+TFGC SAIASSS  TE +KG  + E L + N +IA +L  LP  K+HCS++ ++A++AA+ +Y
Sbjct:   54 ESDKIVDSRFQTFGCTSAIASSSALTEMIKGLTLDEALKVSNKDIADYLGGLPEAKMHCSVMGQEALEAAIYNY 127          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_AQUAE (NifU-like protein OS=Aquifex aeolicus GN=nifU PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.469e-13
Identity = 40/86 (46.51%), Postives = 54/86 (62.79%), Query Frame = 1
Query:    7 ETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDYEAKRTKPSAASE 261
            E   I D  FKTFGCGSAIA SS+ TE VKGK +Q  L++   +I + L  LPP K+HC+ L  + +  A+KDY  K+ +   AS+
Sbjct:   49 ENDVIEDVRFKTFGCGSAIAVSSMLTEMVKGKPIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIKDYLMKQGRVEEASK 134          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_KLEPN (Nitrogen fixation protein nifU OS=Klebsiella pneumoniae GN=nifU PE=3 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 2.249e-12
Identity = 35/79 (44.30%), Postives = 54/79 (68.35%), Query Frame = 1
Query:    1 DEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHL-SLPPVKLHCSMLAEDAIKAAVKDYEAK 234
            D ++  I +A F+TFGCGSAIASSS  TE + G  + E   I N +IA +L  LPP K+HCS++ ++A++AA+ ++  +
Sbjct:   46 DPQSEIIEEAGFQTFGCGSAIASSSALTELIIGHTLAEAGQITNQQIADYLDGLPPEKMHCSVMGQEALRAAIANFRGE 124          
The following BLAST results are available for this feature:
BLAST of FC875607 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
ISU1_SCHPO1.405e-2267.95Iron sulfur cluster assembly protein 1, mitochondr... [more]
NIFU_AZOVI1.152e-1654.43Nitrogen fixation protein nifU OS=Azotobacter vine... [more]
NIFU_AZOCH1.078e-1448.78Nitrogen fixation protein nifU OS=Azotobacter chro... [more]
NIFU_ANASP4.098e-1445.45Nitrogen fixation protein nifU OS=Anabaena sp. (st... [more]
NIFU_ANAAZ5.352e-1448.65Nitrogen fixation protein nifU OS=Anabaena azollae... [more]
NIFU_AQUAE3.469e-1346.51NifU-like protein OS=Aquifex aeolicus GN=nifU PE=1... [more]
NIFU_KLEPN2.249e-1244.30Nitrogen fixation protein nifU OS=Klebsiella pneum... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405G09EF CTVClemen1 Citrus clementina cDNA clone C31405G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875607 ID=FC875607|Name=FC875607|organism=Citrus clementina|type=EST|length=456bp
GATGAAGAGACTGGTCAGATCGTCGACGCCTGCTTCAAGACCTTTGGCTG
TGGCTCGGCCATCGCTTCATCTTCTGTTGCAACGGAATGGGTGAAAGGGA
AGCAGATGCAGGAAGTCTTGTCCATTAAAAACACGGAAATTGCAAAACAT
CTTTCTCTACCACCTGTTAAACTGCATTGCAGCATGCTTGCTGAAGATGC
TATCAAGGCTGCTGTAAAAGATTACGAAGCTAAACGTACCAAACCAAGTG
CTGCTTCAGAGGCAGAACTACCTCCAAGGGCTGCTGATGTTTGAAGATAT
TGATGTAAACATTTGAAAATGATGTTAATGTTCTGCCCGTGGAGATGTAT
CAGGATAACTGCACCTCCTAAAGATTGATGTCGGGTGGTGGAGGGGGNTA
AGTTTATGGTTATTAGTAAGAACTGTGTATGAATATGATCCAGGGACTGC
AGNTTT
back to top