FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 7.799e-113
Identity = 196/208 (94.23%), Postives = 204/208 (98.08%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+R++EIVKEVSSYLKKVGYNP+K+ F+P SGFEGDNMI+RSTNL
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFEEIVKEVSSYLKKVGYNPDKIAFIPISGFEGDNMIDRSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 1.737e-112
Identity = 198/208 (95.19%), Postives = 202/208 (97.12%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIE FEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKY CTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVK MICCCNKMDATTPKYSK+RYDEIVKEVSSYLKKVGYNP+KVPFVP SGFEGDNMIERS+NL
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIESFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYSCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKHMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSSNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_HORVU (Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 2.269e-112
Identity = 198/208 (95.19%), Postives = 203/208 (97.60%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKY CTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTG F+AGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK+RYDEIVKEVSSYLKKVGYNP+KVPFVP SGFEGDNMIERS+NL
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYSCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGVFQAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSSNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 394.815 bits (1013), Expect = 2.348e-109
Identity = 193/208 (92.79%), Postives = 200/208 (96.15%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTT H+IYKLGGIDKRVIERFEKE  EMNKRSFKYAW+LDKLKAERERGITIDIAL KFETTKYY TV+DAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EIVKEVSSYLK+VGYNP+K+PFVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTVHVIYKLGGIDKRVIERFEKEADEMNKRSFKYAWLLDKLKAERERGITIDIALLKFETTKYYSTVMDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKEVGYNPDKIPFVPISGFEGDNMIERSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_DICDI (Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=2)

HSP 1 Score: 351.288 bits (900), Expect = 2.977e-96
Identity = 169/208 (81.25%), Postives = 189/208 (90.87%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVD+GKSTTTGHLIYK GGIDKRVIE++EKE +EM K+SFKYAWV+DKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVL+I S TG FEAGI+K+GQTREHALLA+TLGVKQMI   NKMD  +  YS+ARYDEIVKEVSS++KK+GYNPEKV FVP SG+ GDNM+ERS  +
Sbjct:    1 MGKEKTHINIVVIGHVDAGKSTTTGHLIYKCGGIDKRVIEKYEKEASEMGKQSFKYAWVMDKLKAERERGITIDIALWKFETSKYYFTIIDAPGHRDFIKNMITGTSQADCAVLVIASPTGEFEAGIAKNGQTREHALLAYTLGVKQMIVAINKMDEKSTNYSQARYDEIVKEVSSFIKKIGYNPEKVAFVPISGWNGDNMLERSDKM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_RAT (Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=2 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 5.078e-96
Identity = 170/208 (81.73%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GYNP  VPFVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_RABIT (Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 5.078e-96
Identity = 170/208 (81.73%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GYNP  VPFVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_MOUSE (Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 5.078e-96
Identity = 170/208 (81.73%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GYNP  VPFVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_HUMAN (Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 5.078e-96
Identity = 170/208 (81.73%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GYNP  VPFVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_BOVIN (Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 5.078e-96
Identity = 170/208 (81.73%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFETTKYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RYDEIVKEVS+Y+KK+GYNP  VPFVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNM 208          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A2_DAUCA7.799e-11394.23Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]
EF1A2_HORVU1.737e-11295.19Elongation factor 1-alpha OS=Hordeum vulgare GN=BL... [more]
EF1A1_HORVU2.269e-11295.19Elongation factor 1-alpha OS=Hordeum vulgare PE=1 ... [more]
EF1A_PEA2.348e-10992.79Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_DICDI2.977e-9681.25Elongation factor 1-alpha OS=Dictyostelium discoid... [more]
EF1A2_RAT5.078e-9681.73Elongation factor 1-alpha 2 OS=Rattus norvegicus G... [more]
EF1A2_RABIT5.078e-9681.73Elongation factor 1-alpha 2 OS=Oryctolagus cunicul... [more]
EF1A2_MOUSE5.078e-9681.73Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef... [more]
EF1A2_HUMAN5.078e-9681.73Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF... [more]
EF1A2_BOVIN5.078e-9681.73Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top