FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_STAMF (Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=tuf PE=3 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.303e-67
Identity = 117/208 (56.25%), Postives = 157/208 (75.48%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M   K H+N+VVIGHVD GKST  GH++Y+LG +D++ I+  E+E  +  K SFK+AW+LDKLK ERERG+TI +   KFET +Y  T+IDAPGHRDF+KNMITG SQAD A+L++ +  G FEAG+S +GQTREHA+LA T+G+ Q+I   NKMDAT P +S+ RY++I   +  +LK +GY+  KVPF+P S + GDN+IERS N+
Sbjct:    1 MSSGKPHLNLVVIGHVDHGKSTLVGHILYRLGLVDQKTIQMLEEEAKKRGKESFKFAWLLDKLKEERERGVTIALTYMKFETRRYIFTIIDAPGHRDFVKNMITGASQADAALLVVSARKGEFEAGMSPEGQTREHAILAKTMGINQLIVAVNKMDATEPPWSQKRYEQIKTILGKFLKSLGYDISKVPFIPVSAWTGDNLIERSPNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_RHYAM (Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 4.953e-67
Identity = 123/156 (78.85%), Postives = 138/156 (88.46%), Query Frame = 3
Query:  240 SFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P +S+ RY+EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E S+N+
Sbjct:    2 SFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPFSENRYEEIKKEVSSYIKKIGYNPVAVAFVPISGWHGDNMLEPSSNM 157          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_GIALA (Elongation factor 1-alpha (Fragment) OS=Giardia lamblia GN=TEF1 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 8.449e-67
Identity = 125/189 (66.14%), Postives = 147/189 (77.78%), Query Frame = 3
Query:  144 STTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGY-NPEKVPFVPTSGFEGDNMIERSTNL 707
            ST TGHLIYK GGID+R I+ +EK   EM K SFKYAWVLD+LK ERERGITI+IALWKFET KY  T+IDAPGHRDFIKNMITGTSQAD A+L++ +  G FEAGISKDGQTREHA LA TLG+K MI C NKMD    KYSK RYDEI  E+   LK +G+   E+  ++PTSG+ GDN++E+S  +
Sbjct:    1 STLTGHLIYKCGGIDQRTIDEYEKRATEMGKGSFKYAWVLDQLKDERERGITINIALWKFETKKYIVTIIDAPGHRDFIKNMITGTSQADVAILVVAAGQGEFEAGISKDGQTREHATLANTLGIKTMIICVNKMDDGQVKYSKERYDEIKGEMMKQLKNIGWKKAEEFDYIPTSGWTGDNIMEKSDKM 189          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_AERPE (Elongation factor 1-alpha OS=Aeropyrum pernix GN=tuf PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 8.449e-67
Identity = 114/205 (55.61%), Postives = 155/205 (75.61%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            EK H+N+VVIGHVD GKST  GHL+Y+LG I+++ ++  E++     K SFK+AW+LDK+K ERERGITID+   KFET KY  T+IDAPGHRDF+KNMITG SQAD A+L++ +  G FEAG+S +GQTREH LLA T+G++Q+I   NKMDA    Y + RY+ +V  +  ++K +GY  +K+PF+P S ++GDN+IERS N+
Sbjct:    3 EKPHMNLVVIGHVDHGKSTLVGHLLYRLGYIEEKKLKELEEQAKSRGKESFKFAWILDKMKEERERGITIDLTFMKFETKKYVFTIIDAPGHRDFVKNMITGASQADAAILVVSARKGEFEAGMSTEGQTREHLLLARTMGIEQIIVAVNKMDAPDVNYDQKRYEFVVSVLKKFMKGLGYQVDKIPFIPVSAWKGDNLIERSPNM 207          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_THEPD (Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 7.908e-65
Identity = 114/205 (55.61%), Postives = 157/205 (76.59%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            M ++K H+N+VVIGH+D GKST  G L+Y++G +D R+I+++E+E  +M + ++KYAWVLDKLK ERE+GITID+  +KFET KY+ T+IDAPGHRDF+KNMITG SQAD A+L++ +  G FEAGIS  GQTREH  LA T+GV Q++   NKMD  T  YSK RY+EI  ++   L+ VGY  +++PF+PTS +EG N+ +R+
Sbjct:    1 MSEKKPHLNLVVIGHIDHGKSTLMGRLLYEIGAVDPRLIQQYEEEAKKMGRETWKYAWVLDKLKEEREKGITIDLGFYKFETKKYFFTLIDAPGHRDFVKNMITGASQADVALLVVSAKEGEFEAGISPAGQTREHVFLAKTMGVDQLVVAINKMD--TVNYSKERYEEIKNQLIRLLRMVGYKVDEIPFIPTSAWEGVNVSKRT 203          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METTP (Elongation factor 1-alpha OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=tuf PE=3 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.706e-59
Identity = 107/205 (52.20%), Postives = 143/205 (69.76%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            M   K H+N+  IGHVD GKST  G ++Y++G ID+ +IE++ KE A   K +F++AWV+D LK ERERG+TIDIA  +F+T KYY TV+D PGHRDF+KNMITG SQAD AVL++ +  G          QT+EH  LA TLGV Q+I   NKMDAT P Y + RY+E+ +EV   L+ VGY  ++VPF+P S + GDN+++ S
Sbjct:    1 MADTKPHLNLAFIGHVDHGKSTLVGRMMYEMGAIDEHIIEQYRKEAAAKGKATFEFAWVMDSLKEERERGVTIDIAHQRFDTDKYYFTVVDCPGHRDFVKNMITGASQADAAVLVVAAPDGVM-------AQTKEHVFLARTLGVNQLIVAINKMDATEPPYDEKRYNEVKEEVGKLLRMVGYKIDEVPFIPVSAYNGDNVVKHS 198          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_CENSY (Elongation factor 1-alpha OS=Cenarchaeum symbiosum GN=tuf PE=3 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.706e-59
Identity = 111/212 (52.36%), Postives = 151/212 (71.23%), Query Frame = 3
Query:   75 LTAMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKR-SFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            +TA   +K H+N++V GH+D+GKSTT GH +  LG +D+R I +  +E  +  K  +FKYAWV+D +K ERERGITID+A  KFET KY+ T+IDAPGHRDFIKNMITG S+ADCA+L++ +  G  +  I+  GQ REHA L  TLGV Q+I   NKMD +  KYS+  Y + V++    +K VGY  E VPF+P SG++GDN+++RS N+
Sbjct:    1 MTAHMADKPHLNMIVTGHIDNGKSTTMGHFLMDLGVVDERTIAQHAEESEKTGKGDTFKYAWVMDNIKDERERGITIDLAFQKFETPKYFFTLIDAPGHRDFIKNMITGASEADCAILVLSAKEGETDTAIAAGGQAREHAFLLKTLGVNQLIVAVNKMDDS--KYSEEAYKKTVEKGEGLVKSVGYKLENVPFIPVSGWKGDNLVKRSENM 210          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_SULSO (Elongation factor 1-alpha OS=Sulfolobus solfataricus GN=tuf PE=1 SV=3)

HSP 1 Score: 227.639 bits (579), Expect = 4.965e-59
Identity = 104/205 (50.73%), Postives = 147/205 (71.71%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            +K H+N++VIGH+D GKST  G L+   G ID++ ++  E+   ++ K S K+A++LD+LK ERERG+TI++   +FET KY+ T+IDAPGHRDF+KNMITG SQAD A+L++ +  G +EAG+S +GQTREH +LA T+G+ Q+I   NKMD T P Y + RY EIV +VS +++  G+N  KV FVP     GDN+  RS N+
Sbjct:    3 QKPHLNLIVIGHIDHGKSTLVGRLLMDRGFIDEKTVKEAEEAAKKLGKESEKFAFLLDRLKEERERGVTINLTFMRFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKGEYEAGMSVEGQTREHIILAKTMGLDQLIVAVNKMDLTEPPYDEKRYKEIVDQVSKFMRSYGFNTNKVRFVPVVAPAGDNITHRSENM 207          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PICTO (Elongation factor 1-alpha OS=Picrophilus torridus GN=tuf PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.445e-58
Identity = 109/208 (52.40%), Postives = 150/208 (72.12%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M  EK H+N+V+IGHVD GKST  G L+++ G I + +I+ ++KE  E  K +F++AWV+D+ K ERERG+TID+   KFET KYY T+IDAPGHRDF+KNMITGTSQAD AVL++ +  G    G+    QT+EHA LA TLGV Q+I   NKMDAT P YS+ R++E+  E++  L  +G+  + VP +P SG++GDN+++ S NL
Sbjct:    1 MASEKPHMNLVIIGHVDHGKSTLVGRLLFEHGEIPQHIIDEYKKEAEEKGKATFEFAWVMDRFKEERERGVTIDLTHRKFETDKYYFTIIDAPGHRDFVKNMITGTSQADAAVLVVSAREG---EGVM--AQTKEHAFLARTLGVPQLIAVVNKMDATQPPYSEKRFNEVKDEITKLLTPIGF--KNVPIIPLSGYKGDNIMKPSPNL 201          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_THEAC (Elongation factor 1-alpha OS=Thermoplasma acidophilum GN=tuf PE=3 SV=2)

HSP 1 Score: 225.713 bits (574), Expect = 1.887e-58
Identity = 109/208 (52.40%), Postives = 148/208 (71.15%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M  +K H+N++ IGHVD GKST  G L+Y+ G I   +IE + KE  +  K +F++AWV+D+ K ERERG+TID+A  KFET KYY T+IDAPGHRDF+KNMITGTSQAD A+L+I +  G    G+ +  QTREHA LA TLGV QM+   NKMDAT+P YS+ RY+E+  +    L+ +G+  + + FVP SG++GDN+ + S N+
Sbjct:    1 MASQKPHLNLITIGHVDHGKSTLVGRLLYEHGEIPAHIIEEYRKEAEQKGKATFEFAWVMDRFKEERERGVTIDLAHRKFETDKYYFTLIDAPGHRDFVKNMITGTSQADAAILVISAREG---EGVME--QTREHAFLARTLGVPQMVVAINKMDATSPPYSEKRYNEVKADAEKLLRSIGF--KDISFVPISGYKGDNVTKPSPNM 201          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_STAMF1.303e-6756.25Elongation factor 1-alpha OS=Staphylothermus marin... [more]
EF1A_RHYAM4.953e-6778.85Elongation factor 1-alpha (Fragment) OS=Rhynchosci... [more]
EF1A_GIALA8.449e-6766.14Elongation factor 1-alpha (Fragment) OS=Giardia la... [more]
EF1A_AERPE8.449e-6755.61Elongation factor 1-alpha OS=Aeropyrum pernix GN=t... [more]
EF1A_THEPD7.908e-6555.61Elongation factor 1-alpha OS=Thermofilum pendens (... [more]
EF1A_METTP1.706e-5952.20Elongation factor 1-alpha OS=Methanosaeta thermoph... [more]
EF1A_CENSY1.706e-5952.36Elongation factor 1-alpha OS=Cenarchaeum symbiosum... [more]
EF1A_SULSO4.965e-5950.73Elongation factor 1-alpha OS=Sulfolobus solfataric... [more]
EF1A_PICTO1.445e-5852.40Elongation factor 1-alpha OS=Picrophilus torridus ... [more]
EF1A_THEAC1.887e-5852.40Elongation factor 1-alpha OS=Thermoplasma acidophi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top