FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_SULTO (Elongation factor 1-alpha OS=Sulfolobus tokodaii GN=tuf PE=3 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 5.489e-58
Identity = 102/205 (49.76%), Postives = 147/205 (71.71%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            +K H+N++VIGHVD GKST  G L+   G +D++ I+  E+   ++ K S KYA++LD+LK ERERG+TI++   +FET K++ T+IDAPGHRDF+KNMITG SQAD A+L++ +  G +EAG+S +GQTREH +LA T+G+ Q+I   NKMD T P Y + R+ EIV +V  ++K  G++  KV FVP     G+N+ +RS N+
Sbjct:    3 QKPHLNLIVIGHVDHGKSTLVGRLLMDRGFLDEKTIKEAEEAAKKLGKESEKYAFLLDRLKEERERGVTINLTFMRFETKKFFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKGEYEAGMSAEGQTREHIILAKTMGINQVIVAVNKMDLTDPPYDEKRFKEIVDQVGKFMKSFGFDMNKVKFVPVVAPTGENITQRSENM 207          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METHJ (Elongation factor 1-alpha OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=tuf PE=3 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.223e-57
Identity = 108/208 (51.92%), Postives = 143/208 (68.75%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M  EK HIN+ VIGH+D GKSTT G L+Y+ G +   +IE+++KE     K SF +AWV+D LK ERERGITIDIA  +F+T KYY TV+D PGHRDF+KNMITG SQAD AV+++ +  G  E       QT+EH  L+ TLG+KQ+I   NKMDA    Y +AR++++  +V + LK VG NP+ V F+P S FEGDN+ + S  +
Sbjct:    1 MATEKPHINLAVIGHIDHGKSTTVGRLMYEAGAVPAHIIEQYKKEAESKGKGSFAFAWVMDNLKEERERGITIDIAHKRFDTDKYYFTVVDCPGHRDFVKNMITGASQADAAVIVVAAPDGVME-------QTKEHVFLSKTLGIKQLIVAVNKMDAA--NYDEARFNQVKSDVGALLKMVGTNPDTVKFIPISAFEGDNITKNSDKM 199          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METMA (Elongation factor 1-alpha OS=Methanosarcina mazei GN=tuf PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.558e-57
Identity = 105/205 (51.22%), Postives = 143/205 (69.76%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            M  +K H+N+ VIGH+D GKST  G L+Y  G +   +IE++++E  +  K SF +AWV+D LK ERERGITIDIA  +F+T K+Y TV+D PGHRDF+KNMITG SQAD AVL++ +  G          QT+EH  L+ TLG+ Q+I   NKMDA    YS+ARY E+V++VS  LK +G+ P ++PF+PTS F GDN+++ S
Sbjct:    1 MAADKPHMNLAVIGHIDHGKSTFVGRLMYDAGAVPAHIIEKYKEEAKQKGKESFAFAWVMDSLKEERERGITIDIAHKRFDTDKFYFTVVDCPGHRDFVKNMITGASQADAAVLVVAAPDGVM-------AQTKEHIFLSRTLGINQLIVAINKMDAV--DYSEARYKEVVEQVSGILKMIGFKPSEIPFIPTSAFHGDNIMKLS 196          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METBF (Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.558e-57
Identity = 107/205 (52.20%), Postives = 141/205 (68.78%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            M  +K H+N+ VIGH+D GKST  G L+Y  G +   VIE++++E  +  K SF +AWV+D LK ERERGITIDIA  +F+T KYY TV+D PGHRDF+KNMITG SQAD AVL++ +  G          QT+EH  L+ TLG+ Q+I   NKMDA   +YS+ RY E+V++VS  LK +G+ P  +PFVPTS F GDN++  S
Sbjct:    1 MAADKPHMNLAVIGHIDHGKSTFVGRLMYDAGAVPAHVIEKYKEEAKQKGKESFAFAWVMDSLKEERERGITIDIAHKRFDTDKYYFTVVDCPGHRDFVKNMITGASQADAAVLVVAAPDGVM-------AQTKEHIFLSRTLGINQLIVAINKMDAV--EYSEKRYKEVVEQVSGILKMIGFKPGDIPFVPTSAFYGDNVVNHS 196          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METAC (Elongation factor 1-alpha OS=Methanosarcina acetivorans GN=tuf PE=3 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 4.647e-57
Identity = 104/205 (50.73%), Postives = 143/205 (69.76%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            M  +K H+N+ VIGH+D GKST  G L+Y+ G +   +IE++++E  +  K SF +AWV+D LK ERERGITIDIA  +F+T KYY TV+D PGHRDF+KNMITG SQAD A+L++ +  G          QT+EH  L+ TLG+ Q+I   NKMDA   +YS+A+Y E+V++VS  LK +G+ P  +PF+PTS F GDN+ + S
Sbjct:    1 MAADKPHMNLAVIGHIDHGKSTLVGRLMYEAGAVPAHIIEKYKEEAKQKGKESFAFAWVMDSLKEERERGITIDIAHKRFDTPKYYFTVVDCPGHRDFVKNMITGASQADAAILVVAAPDGVM-------AQTKEHIFLSRTLGINQLIIAINKMDAV--EYSEAKYKEVVEQVSGLLKMIGFKPANIPFIPTSAFMGDNITKLS 196          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METMJ (Elongation factor 1-alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tuf PE=3 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 6.069e-57
Identity = 107/207 (51.69%), Postives = 142/207 (68.60%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            M  EK H+N+ VIGH+D GKSTT G L+++ G +   +IE F KE     K SF++AWV+D LK ERERGITIDIA  +F+T KYY TV+D PGHRDF+KNMITG SQAD A+L++ +  G  E       QT+EH  L+ TLG+ Q+I   NKMDA   KY + RY+E+ +++S  LK VGY P+ + F+P S F GDN+ ++S N
Sbjct:    1 MAAEKPHMNLAVIGHIDHGKSTTVGRLLFETGTVPPHIIESFRKEAESKGKGSFEFAWVMDSLKEERERGITIDIAHKRFDTDKYYFTVVDCPGHRDFVKNMITGASQADAALLVVAAPDGVME-------QTKEHVFLSRTLGINQLIIGINKMDAA--KYDEKRYNEVKEQLSQLLKMVGYKPDDISFIPMSAFVGDNIAKKSEN 198          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_THEVO (Elongation factor 1-alpha OS=Thermoplasma volcanium GN=tuf PE=3 SV=2)

HSP 1 Score: 219.935 bits (559), Expect = 1.035e-56
Identity = 107/208 (51.44%), Postives = 146/208 (70.19%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M  +K H+N++ IGHVD GKST  G L+++ G I   +IE + KE  +  K +F++AWV+D+ K ERERG+TID+A  KFET KYY T+IDAPGHRDF+KNMITGTSQAD A+L+I +  G    G+ +  QTREHA LA TLGV Q++   NKMDAT P +S+ R++E+  +    LK +GY  +   FVP SG++GDN+ + S N+
Sbjct:    1 MASQKPHLNLITIGHVDHGKSTLVGRLLFEHGEIPAHIIEEYRKEAEQKGKATFEFAWVMDRFKEERERGVTIDLAHRKFETDKYYFTLIDAPGHRDFVKNMITGTSQADAAILVISAREG---EGVME--QTREHAFLARTLGVPQIVVAINKMDATEPPFSEKRFNEVKADAEKLLKTIGY--KDATFVPISGYKGDNVTKPSPNM 201          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_SULAC (Elongation factor 1-alpha OS=Sulfolobus acidocaldarius GN=tuf PE=3 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.035e-56
Identity = 101/205 (49.27%), Postives = 146/205 (71.22%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            +K H+N++VIGHVD GKST  G L+   G ID++ ++  E+   ++ K S KYA+++D+LK ERERG+TI+++  +FET KY+ TVIDAPGHRDF+KNMITG SQAD A+L++ +  G +EAG+S +GQTREH +L+ T+G+ Q+I   NKMD     Y + R+ EIV  VS ++K  G++  KV FVP    +GDN+  +ST +
Sbjct:    3 QKPHLNLIVIGHVDHGKSTLIGRLLMDRGFIDEKTVKEAEEAAKKLGKDSEKYAFLMDRLKEERERGVTINLSFMRFETRKYFFTVIDAPGHRDFVKNMITGASQADAAILVVSAKKGEYEAGMSAEGQTREHIILSKTMGINQVIVAINKMDLADTPYDEKRFKEIVDTVSKFMKSFGFDMNKVKFVPVVAPDGDNVTHKSTKM 207          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METBU (Elongation factor 1-alpha OS=Methanococcoides burtonii (strain DSM 6242) GN=tuf PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.766e-56
Identity = 107/204 (52.45%), Postives = 141/204 (69.12%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            +K H+N+ VIGHVD GKST  G L+++ G +   +IE+++ E  E  K SF +AWV+D LK ERERG+TIDI+  +F+T KYY TV+D PGHRDF+KNMITG SQAD AVL++ +  G          QT+EH  L+ TLG+ Q+I   NKMDA   KYS+ RY+E+ KEVS  L  VG+  + VPF+PTS FEGDN+ + S N
Sbjct:    3 DKPHMNLAVIGHVDHGKSTFVGRLMFETGAVPAHLIEKYKAEAKEKGKESFAFAWVMDTLKEERERGVTIDISHKRFDTDKYYFTVVDCPGHRDFVKNMITGASQADAAVLVVAAPDGVM-------AQTKEHVFLSRTLGINQLIVAINKMDAA--KYSEDRYNEVKKEVSQLLGMVGFKADDVPFIPTSAFEGDNITKSSAN 197          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_CALMQ (Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain DSMZ 13496 / IC-167) GN=tuf PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.766e-56
Identity = 102/212 (48.11%), Postives = 142/212 (66.98%), Query Frame = 3
Query:   72 NLTAMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            N T    +K H+N+ +IGHVD GKST TG L+ + G +D++     E E  ++ K  FKYAW++D+LK ERERG+TI+     FET KY+ T+ID PGHRDF+KNMI G SQAD A+L++ +  G FE+G+   GQTREH  LA+TLG++ +I   NKMD     Y + RY++I  E+S  LK + Y+  KVPF+P S   GDN+  +S+N+
Sbjct:    6 NPTESALKKPHLNLAIIGHVDHGKSTLTGRLLLETGYVDEKAFAELEAEAKKLGKEDFKYAWIMDRLKEERERGVTIEAMHVGFETPKYFFTIIDLPGHRDFVKNMIVGASQADAALLVVSARPGEFESGVGPQGQTREHLFLAWTLGIRNLIVAVNKMDVV--NYDQKRYEQIKGELSKILKILRYDVNKVPFIPVSAVRGDNIKVKSSNM 215          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_SULTO5.489e-5849.76Elongation factor 1-alpha OS=Sulfolobus tokodaii G... [more]
EF1A_METHJ1.223e-5751.92Elongation factor 1-alpha OS=Methanospirillum hung... [more]
EF1A_METMA3.558e-5751.22Elongation factor 1-alpha OS=Methanosarcina mazei ... [more]
EF1A_METBF3.558e-5752.20Elongation factor 1-alpha OS=Methanosarcina barker... [more]
EF1A_METAC4.647e-5750.73Elongation factor 1-alpha OS=Methanosarcina acetiv... [more]
EF1A_METMJ6.069e-5751.69Elongation factor 1-alpha OS=Methanoculleus marisn... [more]
EF1A_THEVO1.035e-5651.44Elongation factor 1-alpha OS=Thermoplasma volcaniu... [more]
EF1A_SULAC1.035e-5649.27Elongation factor 1-alpha OS=Sulfolobus acidocalda... [more]
EF1A_METBU1.766e-5652.45Elongation factor 1-alpha OS=Methanococcoides burt... [more]
EF1A_CALMQ1.766e-5648.11Elongation factor 1-alpha OS=Caldivirga maquilinge... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top