FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METS5 (Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.306e-56
Identity = 99/205 (48.29%), Postives = 144/205 (70.24%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            +K H+N++VIGHVD GKST  G L+   G +D++ I+  E+   ++ K S KYA++LD+LK ERERG+TI++   +FET KY+ T+IDAPGHRDF+KNMITG SQAD A+L + +  G FE+G+S +GQTREH +LA T+G+ Q+I    KMD   P Y + RY+EI + +  ++K  G++  KV F+P     G+N+ +RS N+
Sbjct:    3 QKPHLNLIVIGHVDHGKSTLVGRLLMDRGFLDEKTIKEAEEAAKKLGKESEKYAFLLDRLKEERERGVTINLTFMRFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILAVSARKGEFESGMSLEGQTREHIILAKTMGLNQVIVAITKMDVAEPPYDQKRYNEIKETIEKFMKSFGFDMSKVKFIPIVSITGENVTKRSENM 207          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: HBS1L_PONAB (HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.495e-55
Identity = 105/213 (49.30%), Postives = 143/213 (67.14%), Query Frame = 3
Query:   60 EVSVNLTAMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            +V   L      K  +N+VVIGHVD+GKST  GH++Y LG I+KR + ++E+E  +  K SF YAWVLD+   ERERG+T+D+ + KFETT    T++DAPGH+DFI NMITG +QAD AVL++D++ G FEAG    GQTREH LL  +LGV Q+    NKMD     + + R+ EI  ++  +LK+ G+    V F+PTSG  G+N+I RS
Sbjct:  246 DVKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQV--NWQQERFQEITGKLGHFLKQAGFKESDVAFIPTSGLSGENLITRS 456          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: HBS1L_HUMAN (HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.952e-55
Identity = 105/213 (49.30%), Postives = 143/213 (67.14%), Query Frame = 3
Query:   60 EVSVNLTAMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            +V   L      K  +N+VVIGHVD+GKST  GH++Y LG I+KR + ++E+E  +  K SF YAWVLD+   ERERG+T+D+ + KFETT    T++DAPGH+DFI NMITG +QAD AVL++D++ G FEAG    GQTREH LL  +LGV Q+    NKMD     + + R+ EI  ++  +LK+ G+    V F+PTSG  G+N+I RS
Sbjct:  246 DVKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNINKRTMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQV--NWQQERFQEITGKLGHFLKQAGFKESDVGFIPTSGLSGENLITRS 456          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METJA (Elongation factor 1-alpha OS=Methanocaldococcus jannaschii GN=tuf PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.550e-55
Identity = 107/209 (51.20%), Postives = 146/209 (69.86%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKV-GYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M K+K  +N+  IGHVD+GKSTT G L+Y  G ID +++E+ ++E  E  K  F++A+V+D LK ERERG+TID+A  KFET KY  T++D PGHRDFIKNMITG SQAD AVL++D      +A      QTREH  LA TLG+KQ+    NKMD  T  YS+  Y+++ K +S  L KV GYNP+++ F+PT+  +GDN+++RS N+
Sbjct:    1 MAKQKPVLNVAFIGHVDAGKSTTVGRLLYDSGAIDPQLLEKLKREAQERGKAGFEFAYVMDNLKEERERGVTIDVAHKKFETQKYEVTIVDCPGHRDFIKNMITGASQADAAVLVVDVN----DAKTGIQPQTREHMFLARTLGIKQIAVAINKMD--TVNYSQEEYEKMKKMLSEQLLKVLGYNPDQIDFIPTASLKGDNVVKRSENM 203          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: HBS1L_RAT (HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 5.680e-55
Identity = 103/213 (48.36%), Postives = 142/213 (66.67%), Query Frame = 3
Query:   60 EVSVNLTAMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            +V   L      K  +N+VVIGHVD+GKST  GH++Y LG ++KR + ++E+E  +  K SF YAWVLD+   ERERG+T+D+ + KFETT    T++DAPGH+DFI NMITG +QAD AVL++D++ G FEAG    GQTREH LL  +LGV Q+    NKMD     + + R+ EI  ++  +LK+ G+    V F+PTSG  G+N+  RS
Sbjct:  241 DVKAGLEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNVNKRTMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVVTLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQV--NWQQERFQEITGKLGHFLKQAGFKESDVAFIPTSGLSGENLTSRS 451          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: HBS1L_MOUSE (HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 7.419e-55
Identity = 103/213 (48.36%), Postives = 142/213 (66.67%), Query Frame = 3
Query:   60 EVSVNLTAMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            +V   L      K  +N+VVIGHVD+GKST  GH++Y LG ++KR + ++E+E  +  K SF YAWVLD+   ERERG+T+D+ + KFETT    T++DAPGH+DFI NMITG +QAD AVL++D++ G FEAG    GQTREH LL  +LGV Q+    NKMD     + + R+ EI  ++  +LK+ G+    V F+PTSG  G+N+  RS
Sbjct:  244 DVKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNVNKRTMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQV--NWQQERFQEITGKLGHFLKQAGFKESDVAFIPTSGLSGENLTARS 454          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ARCFU (Elongation factor 1-alpha OS=Archaeoglobus fulgidus GN=tuf PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 7.419e-55
Identity = 105/205 (51.22%), Postives = 136/205 (66.34%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            M KEK HIN+  IGHVD GKST  G L+Y+ G I + +IE+  KE  E  K +F++AWV+D+LK ERERG+TID+A  KF+T KYY T++D PGHRDFIKNMITG SQAD AVL++D              QTREH  LA TLG+ Q+I   NKMD     Y +  Y+   + VS  LK VGY  +++PF+P S + GDN+ ++S
Sbjct:    1 MAKEKEHINVAFIGHVDHGKSTLIGRLLYETGEIPEHIIEKMRKEAQEKGKATFEFAWVMDRLKEERERGVTIDVAHRKFQTDKYYITIVDCPGHRDFIKNMITGASQADAAVLVMDVVE-------KVQPQTREHIFLARTLGINQIIVAINKMDRV--NYDQKEYEAAKEAVSKLLKMVGYKVDEIPFIPVSAYYGDNVAKKS 196          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: HBS1L_BOVIN (HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 9.689e-55
Identity = 102/201 (50.75%), Postives = 139/201 (69.15%), Query Frame = 3
Query:   96 KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            K  +N+VVIGHVD+GKST  GHL+Y LG ++KR + ++E+E  +  K SF YAWVLD+   ERERG+T+D+ + KFET     T++DAPGH+DFI NMITG +QAD AVL++D++ G FEAG    GQTREH LL  +LGV Q+    NKMD     + + R+ EI  ++  +LK+ G+    V F+PTSG  G+N+I RS
Sbjct:  260 KQLLNLVVIGHVDAGKSTLMGHLLYLLGDVNKRTMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETKTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQV--NWQQERFQEITGKLGHFLKQAGFKESDVAFIPTSGLSGENLITRS 458          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_UNCMA (Elongation factor 1-alpha OS=Uncultured methanogenic archaeon RC-I GN=tuf PE=3 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 9.689e-55
Identity = 100/205 (48.78%), Postives = 141/205 (68.78%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            M   K HIN+ VIGH+D GKST  G L+++ G +   +IE+++KE     K +F++AWV+D LK ERERGITIDIA  +F+T KYY TV+D PGHRDF+KNMITG SQAD A+L+  +  G  +       QT+EH  L+ TLG+ Q+I   NKMDA    Y + RY+E+ +EVS  L+ +G+ P+++PF+PTS F+G N+ + +
Sbjct:    1 MAATKPHINLAVIGHIDHGKSTLVGRLLFETGAVPAHIIEQYKKEAESKGKGTFEFAWVMDSLKEERERGITIDIAHRRFDTEKYYFTVVDCPGHRDFVKNMITGASQADAAILVCAAPDGVMQ-------QTKEHIFLSKTLGINQLIIAVNKMDAI--NYDQKRYNEVKEEVSKILRMIGFKPDQIPFIPTSAFKGTNIAKHA 196          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PYRCJ (Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.809e-54
Identity = 98/204 (48.04%), Postives = 135/204 (66.18%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            +K HIN+ V+GHVD+GKST  G L+Y+ G +D++  +  E+   +M K  F +AW+LD+ K ERERG+TI+     FET K + T+ID PGHRDF+KNMI G SQAD A+ +I +  G FE  I   GQ REH  L  TLG++Q++   NKMDA    Y + RY+++  EVS  LK +GY+P K+ FVP S  +GDN+  +S N
Sbjct:   14 QKPHINLAVVGHVDNGKSTLVGRLLYETGYVDEKAFKEIEEMAKKMGKEDFAFAWILDRFKEERERGVTIEATHVGFETQKLFITIIDLPGHRDFVKNMIVGASQADAALFVISARPGEFETAIGPQGQGREHLFLIRTLGIQQLVVAVNKMDAV--NYDQKRYEQVKAEVSKLLKLLGYDPSKIHFVPVSAIKGDNVRTKSPN 215          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_METS52.306e-5648.29Elongation factor 1-alpha OS=Metallosphaera sedula... [more]
HBS1L_PONAB1.495e-5549.30HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV... [more]
HBS1L_HUMAN1.952e-5549.30HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV... [more]
EF1A_METJA2.550e-5551.20Elongation factor 1-alpha OS=Methanocaldococcus ja... [more]
HBS1L_RAT5.680e-5548.36HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE... [more]
HBS1L_MOUSE7.419e-5548.36HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV... [more]
EF1A_ARCFU7.419e-5551.22Elongation factor 1-alpha OS=Archaeoglobus fulgidu... [more]
HBS1L_BOVIN9.689e-5550.75HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1[more]
EF1A_UNCMA9.689e-5548.78Elongation factor 1-alpha OS=Uncultured methanogen... [more]
EF1A_PYRCJ4.809e-5448.04Elongation factor 1-alpha OS=Pyrobaculum calidifon... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top