FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PYRAE (Elongation factor 1-alpha OS=Pyrobaculum aerophilum GN=tuf PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 4.809e-54
Identity = 97/204 (47.55%), Postives = 137/204 (67.16%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            +K HIN+ V+GHVD+GKST  G L+Y+ G +D++ ++  E+   ++ K  F +AW+LD+ K ERERG+TI+     FET K + T+ID PGHRDF+KNMI G SQAD A+ +I +  G FEA I   GQ REH  L  TLGV+Q++   NKMD     Y + RY+++  EVS  LK +GY+P K+ F+P S  +GDN+  +S+N
Sbjct:   14 QKPHINLAVVGHVDNGKSTLVGRLLYETGYVDEKALKEIEEMAKKIGKEDFAFAWILDRFKEERERGVTIEATHVGFETNKLFITIIDLPGHRDFVKNMIVGASQADAALFVISARPGEFEAAIGPQGQGREHLFLIRTLGVQQIVVAVNKMDVV--NYDQKRYEQVKAEVSKLLKLLGYDPSKIHFIPVSAIKGDNIKTKSSN 215          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PYRIL (Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189) GN=tuf PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 8.202e-54
Identity = 99/204 (48.53%), Postives = 135/204 (66.18%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            +K H+N+ VIGHVD+GKST  G L+Y+ G +D++  +  E+   +M K  F +AW+LD+ K ERERG+TI+     FET K + T+ID PGHRDFIKNMI G SQAD A+ +I +  G FE  I   GQ REH  L  TLGV+Q++   NKMD     Y + RY++I  EVS  LK +GY+P K+ F+P S  +GDN+  +S+N
Sbjct:   14 QKPHLNLAVIGHVDNGKSTLVGRLLYETGYVDEKAFKEIEEMAKKMGKEDFAFAWILDRFKEERERGVTIEATHVGFETNKLFITIIDLPGHRDFIKNMIVGASQADAALFVISARPGEFETAIGPQGQGREHLFLIRTLGVQQIVVAVNKMDIV--NYDQKRYEQIKAEVSKLLKLLGYDPSKIHFIPVSAIKGDNVKTKSSN 215          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METB6 (Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.071e-53
Identity = 100/201 (49.75%), Postives = 137/201 (68.16%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNM 686
            M  +K H+N+ VIGH+D GKSTT G ++++ G +   +IE + KE     K +F++AWV+D LK ERERGITIDIA  +F+T KYY TV+D PGHRDF+KNMITG SQAD A+L++ +  G  E       QT+EH  LA TLG+ Q+I   NKMDA   K+ + R++E+ KE+S  +K VGY PE+  F+P S  +G N+
Sbjct:    1 MAADKPHMNLAVIGHIDHGKSTTVGRMMFETGAVPAHIIEAYRKEAESKGKATFEFAWVMDNLKEERERGITIDIAHKRFDTPKYYFTVVDCPGHRDFVKNMITGASQADAAILVVAAPDGVME-------QTKEHVFLARTLGITQIIIAINKMDAV--KFDEKRFNEVKKELSDLIKMVGYKPEETLFIPISSLQGINI 192          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PYRAR (Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.399e-53
Identity = 97/204 (47.55%), Postives = 135/204 (66.18%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            +K HIN+ V+GHVD+GKST  G L+Y+ G +D++  +  E+   +M K  F +AW+LD+ K ERERG+TI+     FET K + T+ID PGHRDF+KNMI G SQAD A+ +I +  G FE  I   GQ REH  L  TLG++Q++   NKMD     Y + RY+++  EVS  LK +GY+P K+ FVP S  +GDN+  +S+N
Sbjct:   14 QKPHINLAVVGHVDNGKSTLVGRLLYETGYVDEKGFKEIEEMAKKMGKEDFAFAWILDRFKEERERGVTIEATHVGFETNKLFITIIDLPGHRDFVKNMIVGASQADAALFVISARPGEFETAIGPQGQGREHLFLIRTLGIQQLVVAVNKMDVV--NYDQKRYEQVKSEVSKLLKLLGYDPSKIHFVPVSAVKGDNVRTKSSN 215          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METLZ (Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.117e-53
Identity = 99/207 (47.83%), Postives = 138/207 (66.67%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            M   K H+N+ VIGH+D GKSTT G ++++ G + + +++ ++KE     K +F++AWV+D LK ERERGITIDIA  KFET KY  TV+D PGHRDF+KNMITG SQAD A++++  T G  E       QT+EH  L+ TLG+ Q+I   NKMDA    YS+ +Y+E   +++  +  VG+ P + PF+P S F GDN+ E S N
Sbjct:    1 MAAAKPHMNLAVIGHIDHGKSTTVGRILFETGVVQQHILDGYKKEAESKGKATFEFAWVMDSLKEERERGITIDIAHKKFETPKYNFTVVDCPGHRDFVKNMITGASQADAAIIVVSGTEGPME-------QTKEHVFLSKTLGINQIIVAINKMDAV--NYSEEKYNEAKDKMTKLIMSVGFKPAETPFIPISAFCGDNIKEASAN 198          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_METPE (Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 4.071e-53
Identity = 99/205 (48.29%), Postives = 138/205 (67.32%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            M  +K H+N+ VIGH+D GKSTT G L+++ G +   +IE F KE     K SF++AWV+D LK ERERGITIDIA  +F+T K+Y TV+D PGHRDF+KNMITG SQAD A+L++ +  G  E       QT+EH  LA TLG+ Q++   NKMDA    Y + R++E+ KE++  +  VGY   ++ F+P S F+G N+ ++S
Sbjct:    1 MANDKPHMNLAVIGHIDHGKSTTVGRLMFETGAVPAHIIENFRKEAESKGKGSFEFAWVMDNLKEERERGITIDIAHKRFDTAKFYFTVVDCPGHRDFVKNMITGASQADAAILVVAAPDGVME-------QTKEHVFLARTLGITQLVIAINKMDAV--NYDQKRFEEVKKELTQLIGMVGYKAAEILFIPMSSFKGVNISKKS 196          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PYRFU (Elongation factor 1-alpha OS=Pyrococcus furiosus GN=tuf PE=3 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 5.317e-53
Identity = 108/208 (51.92%), Postives = 145/208 (69.71%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M K+K H+NIV IGHVD GKSTT G L+Y  G I +++I++FE E+ E  K SFK+AWV+D+LK ERERGITID+A  KFET   Y T+IDAPGHRDF+KNMITG SQAD AVL++ +T G          QT+EHA LA TLG+K +I   NKMD     Y++ R++E+  +V   LK +GY  +  P +P S +EG+N++++S  +
Sbjct:    1 MPKDKPHVNIVFIGHVDHGKSTTIGRLLYDTGNIPEQIIKKFE-EMGEKGK-SFKFAWVMDRLKEERERGITIDVAHTKFETPHRYITIIDAPGHRDFVKNMITGASQADAAVLVVAATDGVMP-------QTKEHAFLARTLGIKHIIVAINKMDMV--NYNQKRFEEVKAQVEKLLKMLGY--KDFPVIPISAWEGENVVKKSDKM 195          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_THESM (Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 9.069e-53
Identity = 109/208 (52.40%), Postives = 144/208 (69.23%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M KEK H+NIV IGHVD GKSTT G L++    I +++I++FE E+ E  K SFK+AWV+D+LK ERERGITID+A  KFET   Y T+IDAPGHRDF+KNMITG SQAD AVLI+ +T G          QT+EHA LA TLG+  +I   NKMDA   KY + R+ E+  +V+  L+ +GY  +  P +P S +EGDN++++S  +
Sbjct:    1 MAKEKPHVNIVFIGHVDHGKSTTIGRLLFDTANIPEQIIKKFE-EMGEKGK-SFKFAWVMDRLKEERERGITIDVAHTKFETPHRYITIIDAPGHRDFVKNMITGASQADAAVLIVAATDGVMP-------QTKEHAFLARTLGINHIIVGVNKMDAV--KYDEKRFKEVATQVTKLLQMLGY--KNFPVIPISAWEGDNVVKKSDKM 195          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PYRWO (Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.184e-52
Identity = 107/208 (51.44%), Postives = 145/208 (69.71%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M K+K H+NIV IGHVD GKSTT G L+Y  G I +++I++FE E+ E  K SFK+AWV+D+L+ ERERGITID+A  KFET   Y T+IDAPGHRDF+KNMITG SQAD AVL++ +T G          QT+EHA LA TLG+K +I   NKMD     Y++ R++E+  +V   LK +GY  +  P +P S +EG+N++++S  +
Sbjct:    3 MPKDKPHVNIVFIGHVDHGKSTTIGRLLYDTGNIPEQIIKKFE-EMGEKGK-SFKFAWVMDRLREERERGITIDVAHTKFETPHRYITIIDAPGHRDFVKNMITGASQADAAVLVVAATDGVMP-------QTKEHAFLARTLGIKHIIVAINKMDMV--NYNQKRFEEVKAQVEKLLKMLGY--KDFPVIPISAWEGENVVKKSDKM 197          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: ERF3A_MOUSE (Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus GN=Gspt1 PE=1 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.020e-52
Identity = 98/203 (48.28%), Postives = 140/203 (68.97%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEK-VPFVPTSGFEGDNMIERS 698
            +K H+N+V IGHVD+GKST  G ++Y  G +DKR +E++E+E  E N+ ++  +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G SQAD AVL+I +  G FE G  K GQTREHA+LA T GVK +I   NKMD  T  +S  RY+E  +++  +LKKVG+NP+K + F+P SG  G N+ E+S
Sbjct:   71 KKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQS 273          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_PYRAE4.809e-5447.55Elongation factor 1-alpha OS=Pyrobaculum aerophilu... [more]
EF1A_PYRIL8.202e-5448.53Elongation factor 1-alpha OS=Pyrobaculum islandicu... [more]
EF1A_METB61.071e-5349.75Elongation factor 1-alpha OS=Methanoregula boonei ... [more]
EF1A_PYRAR1.399e-5347.55Elongation factor 1-alpha OS=Pyrobaculum arsenatic... [more]
EF1A_METLZ3.117e-5347.83Elongation factor 1-alpha OS=Methanocorpusculum la... [more]
EF1A_METPE4.071e-5348.29Elongation factor 1-alpha OS=Methanosphaerula palu... [more]
EF1A_PYRFU5.317e-5351.92Elongation factor 1-alpha OS=Pyrococcus furiosus G... [more]
EF1A_THESM9.069e-5352.40Elongation factor 1-alpha OS=Thermococcus sibiricu... [more]
EF1A_PYRWO1.184e-5251.44Elongation factor 1-alpha OS=Pyrococcus woesei GN=... [more]
ERF3A_MOUSE2.020e-5248.28Eukaryotic peptide chain release factor GTP-bindin... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top