FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_DANRE (Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 7.333e-95
Identity = 168/208 (80.77%), Postives = 185/208 (88.94%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+AR++EI KEVS+Y+KK+GYNP  V FVP SG+ GDNM+E S+N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEITKEVSAYIKKIGYNPASVAFVPISGWHGDNMLEASSNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_EUGGR (Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 9.577e-95
Identity = 171/208 (82.21%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HI++VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE +EM K SFKYAWVLDKLKAERER ITIDIALWKFET K   T+IDAPGHRDFIKNMITGTSQAD AVL+IDSTTGGFEAGISKDGQTREHALLA+TLGVKQMI   NK D  T KYS+ARY+EI KEVS YLKKVGYNPEKVPF+P SG+ GDNMIE S N+
Sbjct:    1 MGKEKVHISLVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEASEMGKGSFKYAWVLDKLKAERERCITIDIALWKFETAKSVFTIIDAPGHRDFIKNMITGTSQADAAVLVIDSTTGGFEAGISKDGQTREHALLAYTLGVKQMIVATNKFDDKTVKYSQARYEEIKKEVSGYLKKVGYNPEKVPFIPISGWNGDNMIEASENM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_CHICK (Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 9.577e-95
Identity = 167/208 (80.29%), Postives = 187/208 (89.90%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S+N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSSNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A3_HUMAN (Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1AL3 PE=5 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_RAT (Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_RABIT (Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_PONAB (Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_PANTR (Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_MOUSE (Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_HUMAN (Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_DANRE7.333e-9580.77Elongation factor 1-alpha OS=Danio rerio GN=eef1a ... [more]
EF1A_EUGGR9.577e-9582.21Elongation factor 1-alpha OS=Euglena gracilis GN=T... [more]
EF1A_CHICK9.577e-9580.29Elongation factor 1-alpha 1 OS=Gallus gallus GN=EE... [more]
EF1A3_HUMAN1.251e-9480.29Putative elongation factor 1-alpha-like 3 OS=Homo ... [more]
EF1A1_RAT1.251e-9480.29Elongation factor 1-alpha 1 OS=Rattus norvegicus G... [more]
EF1A1_RABIT1.251e-9480.29Elongation factor 1-alpha 1 OS=Oryctolagus cunicul... [more]
EF1A1_PONAB1.251e-9480.29Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF... [more]
EF1A1_PANTR1.251e-9480.29Elongation factor 1-alpha 1 OS=Pan troglodytes GN=... [more]
EF1A1_MOUSE1.251e-9480.29Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef... [more]
EF1A1_HUMAN1.251e-9480.29Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top