FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_HORSE (Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_FELCA (Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_CRIGR (Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_BOVIN (Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.251e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_DROME (Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2)

HSP 1 Score: 345.51 bits (885), Expect = 1.634e-94
Identity = 169/208 (81.25%), Postives = 184/208 (88.46%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD++ P YS+ARY+EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E STN+
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A0_XENLA (Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 1.634e-94
Identity = 167/208 (80.29%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P YS+ RY+EIVKEVS+Y+KK+GYNP+ V FVP SG+ GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSPNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ONCVO (Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 2.787e-94
Identity = 165/208 (79.33%), Postives = 182/208 (87.50%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGI IDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQMI  CNKMD+T P +S+AR+ E+  EVS+Y+KK+GYNP+ +PFVP SGF GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGIQIDIALWKFETPKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTDPPFSEARFGEVTTEVSNYIKKIGYNPKSIPFVPISGFNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_BOMMO (Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 4.753e-94
Identity = 168/208 (80.77%), Postives = 184/208 (88.46%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E ST +
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A4_OSCTI (Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 6.208e-94
Identity = 164/208 (78.85%), Postives = 182/208 (87.50%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQMI  CNKMD+T P +S+ R++EI+ EV S++KK+GYNP  +PFVP SGF GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTEPPFSEKRFEEIITEVKSFIKKIGYNPATIPFVPISGFNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_OSCTI (Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 6.208e-94
Identity = 164/208 (78.85%), Postives = 182/208 (87.50%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQMI  CNKMD+T P +S+ R++EI+ EV S++KK+GYNP  +PFVP SGF GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTEPPFSEKRFEEIITEVKSFIKKIGYNPATIPFVPISGFNGDNMLEPSANM 208          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A1_HORSE1.251e-9480.29Elongation factor 1-alpha 1 OS=Equus caballus GN=E... [more]
EF1A1_FELCA1.251e-9480.29Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1... [more]
EF1A1_CRIGR1.251e-9480.29Elongation factor 1-alpha 1 OS=Cricetulus griseus ... [more]
EF1A1_BOVIN1.251e-9480.29Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A... [more]
EF1A1_DROME1.634e-9481.25Elongation factor 1-alpha 1 OS=Drosophila melanoga... [more]
EF1A0_XENLA1.634e-9480.29Elongation factor 1-alpha, somatic form OS=Xenopus... [more]
EF1A_ONCVO2.787e-9479.33Elongation factor 1-alpha OS=Onchocerca volvulus P... [more]
EF1A_BOMMO4.753e-9480.77Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1[more]
EF1A4_OSCTI6.208e-9478.85Elongation factor 1-alpha 4 OS=Oscheius tipulae GN... [more]
EF1A2_OSCTI6.208e-9478.85Elongation factor 1-alpha 2 OS=Oscheius tipulae GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top