FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_CAEEL (Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 8.108e-94
Identity = 165/208 (79.33%), Postives = 182/208 (87.50%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQ+I  CNKMD+T P +S+AR+ EI  EVS ++KK+GYNP+ VPFVP SGF GDNM+E S+N+
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_DROME (Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=1 SV=2)

HSP 1 Score: 343.199 bits (879), Expect = 8.108e-94
Identity = 168/208 (80.77%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ARY+EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E S  +
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A3_XENLA (Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2)

HSP 1 Score: 342.813 bits (878), Expect = 1.059e-93
Identity = 166/208 (79.81%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+    G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P +S+ R++EI KEVS+Y+KK+GYNP  VPFVP SG+ GDNM+E STN+
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETGKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIIGVNKMDSTEPPFSQKRFEEITKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEASTNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A3_OSCTI (Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 3.081e-93
Identity = 167/209 (79.90%), Postives = 183/209 (87.56%), Query Frame = 3
Query:   84 MGK-EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGK +KTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQMI  CNKMD+T P +S+ R+DEIV EV S+LKKVGYNP  +PFVP SGF GDNM+E S+N+
Sbjct:    1 MGKGDKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTEPPFSEKRFDEIVTEVKSFLKKVGYNPATIPFVPISGFNGDNMLEPSSNM 209          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_XENLA (Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 3.081e-93
Identity = 165/208 (79.33%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDI+LWKFET K+Y T+IDAPGHRDFIKNMITGTSQADCAVLI+    G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P +S+ R++EI KEVS+Y+KK+GYNP  VPFVP SG+ GDNM+E STN+
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETGKFYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIIGVNKMDSTEPPFSQKRFEEITKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEASTNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_OSCTI (Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 3.081e-93
Identity = 163/208 (78.37%), Postives = 181/208 (87.02%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET K+Y T+IDAPGHRDFIK MITGTSQADCAVL++   TG FEAGISK+GQTREHALLA TLGVKQMI  CNKMD+T P +S+ R++EI+ EV S++KK+GYNP  +PFVP SGF GDNM+E S N+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKFYVTIIDAPGHRDFIKKMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQMIVACNKMDSTEPPFSEKRFEEIITEVKSFIKKIGYNPATIPFVPISGFNGDNMLEPSANM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_AURPU (Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 1.171e-92
Identity = 167/207 (80.68%), Postives = 183/207 (88.41%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKEK+HIN+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLK+ERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  K+S+ARY EI+KE S ++KKVGYNP+ VPFVP SGF GDNMIE S+N
Sbjct:    1 MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKSERERGITIDIALWKFETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEARYQEIIKETSGFIKKVGYNPKHVPFVPISGFNGDNMIEVSSN 205          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ABSGL (Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 1.171e-92
Identity = 163/208 (78.37%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADC +LII + TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD+T  K+S+ R++EI+KEVS ++KK+G+NP+ VPFVP SG+ GDNM+E STN+
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCGILIIAAGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDST--KWSEQRFNEIIKEVSGFIKKIGFNPKSVPFVPISGWHGDNMLEESTNM 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ORYLA (Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.529e-92
Identity = 165/208 (79.33%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+AR++EI KEVS+Y+KK+GYNP  V FVP SG+ GDNM+E S  +
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSTYIKKIGYNPAAVAFVPISGWHGDNMLEASDKM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A3_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-3 PE=3 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.529e-92
Identity = 165/208 (79.33%), Postives = 184/208 (88.46%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T  K+S+ RY+EIVKEVS ++KK+G+NP+ VPFVP SG+ GDNM++ STN+
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSQDRYNEIVKEVSGFIKKIGFNPKSVPFVPISGWHGDNMLDESTNM 206          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_CAEEL8.108e-9479.33Elongation factor 1-alpha OS=Caenorhabditis elegan... [more]
EF1A2_DROME8.108e-9480.77Elongation factor 1-alpha 2 OS=Drosophila melanoga... [more]
EF1A3_XENLA1.059e-9379.81Elongation factor 1-alpha, oocyte form OS=Xenopus ... [more]
EF1A3_OSCTI3.081e-9379.90Elongation factor 1-alpha 3 OS=Oscheius tipulae GN... [more]
EF1A2_XENLA3.081e-9379.33Elongation factor 1-alpha, oocyte form OS=Xenopus ... [more]
EF1A1_OSCTI3.081e-9378.37Elongation factor 1-alpha 1 OS=Oscheius tipulae GN... [more]
EF1A_AURPU1.171e-9280.68Elongation factor 1-alpha OS=Aureobasidium pullula... [more]
EF1A_ABSGL1.171e-9278.37Elongation factor 1-alpha OS=Absidia glauca GN=TEF... [more]
EF1A_ORYLA1.529e-9279.33Elongation factor 1-alpha OS=Oryzias latipes GN=ee... [more]
EF1A3_RHIRA1.529e-9279.33Elongation factor 1-alpha OS=Rhizomucor racemosus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top