FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PODCU (Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 2.608e-92
Identity = 168/208 (80.77%), Postives = 185/208 (88.94%), Query Frame = 3
Query:   84 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKE KTHIN+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  K+S+AR++EI+KE S+++KKVGYNP+ V FVP SGF GDNM+E STN
Sbjct:    1 MGKEDKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEARFNEIIKETSNFIKKVGYNPKTVAFVPISGFNGDNMLEASTN 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PODAN (Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 2.608e-92
Identity = 168/208 (80.77%), Postives = 185/208 (88.94%), Query Frame = 3
Query:   84 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKE KTHIN+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  K+S+AR++EI+KE S+++KKVGYNP+ V FVP SGF GDNM+E STN
Sbjct:    1 MGKEDKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--KWSEARFNEIIKETSNFIKKVGYNPKTVAFVPISGFNGDNMLEASTN 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_CANAL (Elongation factor 1-alpha OS=Candida albicans GN=TEF1 PE=1 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 3.406e-92
Identity = 165/207 (79.71%), Postives = 183/207 (88.41%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD+   K+ K R++EI+KE S+++KKVGYNP+ VPFVP SG+ GDNMIE STN
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDSV--KWDKNRFEEIIKETSNFVKKVGYNPKTVPFVPISGWNGDNMIEPSTN 205          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_COCIM (Elongation factor 1-alpha OS=Coccidioides immitis GN=TEF PE=2 SV=2)

HSP 1 Score: 337.421 bits (864), Expect = 4.449e-92
Identity = 168/208 (80.77%), Postives = 186/208 (89.42%), Query Frame = 3
Query:   84 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKE KTHIN+VVIGHVDSGKSTTTGHLIYK GGID R IE+FEKE  E+ K+SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLAFTLGVKQ+I   NKMD+T   +S+ R++EIVKEVS+++KKVGYNP+ VPFVP SGFEGDNMI+ STN
Sbjct:    1 MGKEEKTHINLVVIGHVDSGKSTTTGHLIYKCGGIDNRTIEKFEKEAEELGKKSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAFTLGVKQLIVAINKMDST--NWSEPRFNEIVKEVSNFIKKVGYNPKAVPFVPISGFEGDNMIQPSTN 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PICGU (Elongation factor 1-alpha OS=Pichia guilliermondii GN=TEF1 PE=3 SV=2)

HSP 1 Score: 337.035 bits (863), Expect = 5.810e-92
Identity = 164/207 (79.23%), Postives = 183/207 (88.41%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLA+TLGV+Q+I   NKMD+   K+ K R++EI+KE S+++KKVGYNP+ VPFVP SG+ GDNMIE STN
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAYTLGVRQLIVAVNKMDSV--KWDKNRFEEIIKETSNFVKKVGYNPKTVPFVPISGWNGDNMIEASTN 205          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-2 PE=3 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 5.810e-92
Identity = 164/208 (78.85%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLG +Q+I   NKMD T  K+S+ RY+EIVKEVS ++KK+G+NP+ VPFVP SG+ GDNM++ STN+
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGFRQLIVAINKMDTT--KWSQDRYNEIVKEVSGFIKKIGFNPKSVPFVPISGWHGDNMLDESTNM 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ASHGO (Elongation factor 1-alpha OS=Ashbya gossypii GN=TEF PE=3 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 9.911e-92
Identity = 164/207 (79.23%), Postives = 182/207 (87.92%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY+ TVIDAPGHRDFIKNMITGTSQADCA+LII    G FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD+   K+ ++RY EIVKE S+++KKVGYNP+ VPFVP SG+ GDNMIE +TN
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDSV--KWDESRYQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTN 205          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ARTSA (Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2)

HSP 1 Score: 336.265 bits (861), Expect = 9.911e-92
Identity = 164/208 (78.85%), Postives = 181/208 (87.02%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLA+TLGVKQ+I   NKMD+T P +S+AR++EI KEVS+Y+KK+GYNP  V FVP SG+ GDNM+E S  L
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPFSEARFEEIKKEVSAYIKKIGYNPAAVAFVPISGWHGDNMLEASDRL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_SCHPO (Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe GN=tef1a PE=1 SV=2)

HSP 1 Score: 336.265 bits (861), Expect = 9.911e-92
Identity = 166/208 (79.81%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HIN+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  E+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCAVLII   TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T   +S+AR++EIVKE S+++KKVG+NP+ VPFVP SGF+GDNMIE +TN+
Sbjct:    1 MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAVLIIGGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDTT--GWSQARFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQGDNMIEPTTNM 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_RHIRA (Elongation factor 1-alpha OS=Rhizomucor racemosus GN=TEF-1 PE=3 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 9.911e-92
Identity = 164/208 (78.85%), Postives = 182/208 (87.50%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLG +Q+I   NKMD T  K+S+ RY+EIVKEVS ++KK+G+NP+ VPFVP SG+ GDNM++ STN+
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEEFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGFRQLIVAINKMDTT--KWSQDRYNEIVKEVSGFIKKIGFNPKSVPFVPISGWHGDNMLDESTNM 206          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_PODCU2.608e-9280.77Elongation factor 1-alpha OS=Podospora curvicolla ... [more]
EF1A_PODAN2.608e-9280.77Elongation factor 1-alpha OS=Podospora anserina GN... [more]
EF1A_CANAL3.406e-9279.71Elongation factor 1-alpha OS=Candida albicans GN=T... [more]
EF1A_COCIM4.449e-9280.77Elongation factor 1-alpha OS=Coccidioides immitis ... [more]
EF1A_PICGU5.810e-9279.23Elongation factor 1-alpha OS=Pichia guilliermondii... [more]
EF1A2_RHIRA5.810e-9278.85Elongation factor 1-alpha OS=Rhizomucor racemosus ... [more]
EF1A_ASHGO9.911e-9279.23Elongation factor 1-alpha OS=Ashbya gossypii GN=TE... [more]
EF1A_ARTSA9.911e-9278.85Elongation factor 1-alpha OS=Artemia salina PE=1 S... [more]
EF1A1_SCHPO9.911e-9279.81Elongation factor 1-alpha-A OS=Schizosaccharomyces... [more]
EF1A1_RHIRA9.911e-9278.85Elongation factor 1-alpha OS=Rhizomucor racemosus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top