FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_SCHPO (Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe GN=tef1b PE=1 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 1.294e-91
Identity = 165/208 (79.33%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HIN+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  E+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T   +S+AR++EIVKE S+++KKVG+NP+ VPFVP SGF+GDNMIE +TN+
Sbjct:    1 MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDTT--GWSQARFEEIVKETSNFIKKVGFNPKTVPFVPVSGFQGDNMIEPTTNM 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_TRYBB (Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=1 SV=3)

HSP 1 Score: 334.724 bits (857), Expect = 2.884e-91
Identity = 162/208 (77.88%), Postives = 180/208 (86.54%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK H+N+VV+GHVD+GKST TGHLIYK GGIDKR IE+FEKE A++ K SFKYAWVLDKLKAERERGITIDIALWKFE+ K   T+IDAPGHRDFIKNMITGTSQAD A+LII S  G FEAGISKDGQTREHALLAFTLGVKQM+ CCNKMD  T  Y + RYDEIVKEVS+Y+KKVGYN EKV FVP SG++GDNMIE+S  +
Sbjct:    1 MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAADIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASAQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVNYGQERYDEIVKEVSAYIKKVGYNVEKVRFVPISGWQGDNMIEKSEKM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_APIME (Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 2.884e-91
Identity = 165/205 (80.49%), Postives = 178/205 (86.83%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ +  G FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD T P YS+AR++EI KEVSSY+KK+GYN   V FVP SG+ GDNM+E S
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGIGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDMTDPPYSEARFEEIKKEVSSYIKKIGYNTASVAFVPISGWHGDNMLEPS 205          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_AJECG (Elongation factor 1-alpha OS=Ajellomyces capsulata (strain ATCC 26029 / G186AR / H82 / RMSCC 2432) GN=TEF PE=2 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 3.766e-91
Identity = 166/208 (79.81%), Postives = 185/208 (88.94%), Query Frame = 3
Query:   84 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKE KTHIN+VVIGHVDSGKSTTTGHLIYK GGID R IE+FEKE  E+ K+SFKYAWVLDKLK+ERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T  K+S++R++EI+KEVS+++KKVGYNP+ VPFVP SGFEGDNMIE S N
Sbjct:    1 MGKEDKTHINLVVIGHVDSGKSTTTGHLIYKCGGIDSRTIEKFEKEAEELGKKSFKYAWVLDKLKSERERGITIDIALWKFETPKYSVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSESRFNEIIKEVSNFIKKVGYNPKAVPFVPISGFEGDNMIEPSPN 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_TETPY (Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 4.919e-91
Identity = 162/204 (79.41%), Postives = 177/204 (86.76%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            +K HIN+VVIGHVDSGKSTTTGHLIYK GGIDKRVIE+FEKE AE  K SFKYAWVLDKLKAERERGITIDI+LWKFET KY+ T+IDAPGHRDFIKNMITGTSQAD A+L+I S  G FEAGISKDGQTREHALLAFTLGVKQMI C NKMD  T  +S+ RY EI KE+S YLKKVGY P+ +PF+P SGF GDNM+ERSTN
Sbjct:    5 DKVHINLVVIGHVDSGKSTTTGHLIYKCGGIDKRVIEKFEKESAEQGKGSFKYAWVLDKLKAERERGITIDISLWKFETAKYHFTIIDAPGHRDFIKNMITGTSQADVAILMIASPQGEFEAGISKDGQTREHALLAFTLGVKQMIVCLNKMDEKTVNFSEERYQEIKKELSDYLKKVGYKPDTIPFIPISGFNGDNMLERSTN 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ARXAD (Elongation factor 1-alpha OS=Arxula adeninivorans GN=TEF PE=3 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 4.919e-91
Identity = 164/207 (79.23%), Postives = 182/207 (87.92%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKEKTH+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERER ITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD+    +S+ RY+EIVKE S+++KKVG+NP+ VPFVP SG+ GDNMIE +TN
Sbjct:    1 MGKEKTHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERVITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDSV--NWSEDRYNEIVKETSNFIKKVGFNPKAVPFVPISGWNGDNMIEATTN 205          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ASPOR (Elongation factor 1-alpha OS=Aspergillus oryzae GN=tef1 PE=3 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 6.424e-91
Identity = 168/208 (80.77%), Postives = 184/208 (88.46%), Query Frame = 3
Query:   84 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKE K HINIVVIGHVDSGKSTTTGHLIYK GGID+R IE+FEKE AE+ K SFKYAWVLDKLK+ERERGITIDIALWKF+T+KY  TVIDAPGHRDFIKNMITGTSQADCA+LII S TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD  T K+S+ RY+EIVKE S+++KKVGYNP+ VPFVP SGF GDNMIE STN
Sbjct:    1 MGKEDKQHINIVVIGHVDSGKSTTTGHLIYKCGGIDQRTIEKFEKEAAELGKGSFKYAWVLDKLKSERERGITIDIALWKFQTSKYEVTVIDAPGHRDFIKNMITGTSQADCAILIIASGTGEFEAGISKDGQTREHALLAFTLGVRQLIVALNKMD--TCKWSQDRYNEIVKETSNFIKKVGYNPKSVPFVPISGFNGDNMIEASTN 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_YARLI (Elongation factor 1-alpha OS=Yarrowia lipolytica GN=TEF PE=2 SV=2)

HSP 1 Score: 333.183 bits (853), Expect = 8.390e-91
Identity = 163/207 (78.74%), Postives = 181/207 (87.44%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKEKTH+N+VVIGHVD+GKSTTTGHLIYK GGIDKR IE+FEKE  E+ K SFKYAWVLDKLKAERERGITIDIALWKF+T KYY TVIDAPGHRDFIKNMITGTSQADCA+LII    G FEAGISKDGQTREHALLAFTLGVKQ+I   NKMD+   K+S+ RY+EI KE ++++KKVGYNP+ VPFVP SG+ GDNMIE STN
Sbjct:    1 MGKEKTHVNLVVIGHVDAGKSTTTGHLIYKCGGIDKRTIEKFEKEADELGKGSFKYAWVLDKLKAERERGITIDIALWKFQTPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVKQLIVAINKMDSV--KWSQDRYNEICKETANFVKKVGYNPKSVPFVPISGWNGDNMIEASTN 205          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_SORMA (Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 1.096e-90
Identity = 165/208 (79.33%), Postives = 182/208 (87.50%), Query Frame = 3
Query:   84 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKE K HIN+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  ++S+AR++EI+KE  +++KKVGYNP  V FVP SGF GDNM+E STN
Sbjct:    1 MGKEDKAHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--QWSQARFEEIIKETKNFIKKVGYNPATVAFVPISGFNGDNMLEASTN 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PUCGR (Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2)

HSP 1 Score: 332.798 bits (852), Expect = 1.096e-90
Identity = 164/208 (78.85%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK H+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T  K+S+ R+ EIVKE S+++KKVGYNP+ + FVP SG+ GDNM+E STN+
Sbjct:    1 MGKEKNHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTT--KWSEQRF-EIVKETSNFVKKVGYNPKSIAFVPISGWHGDNMLEESTNM 205          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A2_SCHPO1.294e-9179.33Elongation factor 1-alpha-B/C OS=Schizosaccharomyc... [more]
EF1A_TRYBB2.884e-9177.88Elongation factor 1-alpha OS=Trypanosoma brucei br... [more]
EF1A_APIME2.884e-9180.49Elongation factor 1-alpha OS=Apis mellifera PE=3 S... [more]
EF1A_AJECG3.766e-9179.81Elongation factor 1-alpha OS=Ajellomyces capsulata... [more]
EF1A_TETPY4.919e-9179.41Elongation factor 1-alpha OS=Tetrahymena pyriformi... [more]
EF1A_ARXAD4.919e-9179.23Elongation factor 1-alpha OS=Arxula adeninivorans ... [more]
EF1A_ASPOR6.424e-9180.77Elongation factor 1-alpha OS=Aspergillus oryzae GN... [more]
EF1A_YARLI8.390e-9178.74Elongation factor 1-alpha OS=Yarrowia lipolytica G... [more]
EF1A_SORMA1.096e-9079.33Elongation factor 1-alpha OS=Sordaria macrospora G... [more]
EF1A_PUCGR1.096e-9078.85Elongation factor 1-alpha OS=Puccinia graminis GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top