FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_YEAST (Elongation factor 1-alpha OS=Saccharomyces cerevisiae GN=TEF1 PE=1 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.431e-90
Identity = 163/207 (78.74%), Postives = 181/207 (87.44%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKEK+HIN+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII    G FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD+   K+ ++R+ EIVKE S+++KKVGYNP+ VPFVP SG+ GDNMIE +TN
Sbjct:    1 MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSV--KWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTN 205          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_NEUCR (Elongation factor 1-alpha OS=Neurospora crassa GN=tef-1 PE=3 SV=2)

HSP 1 Score: 332.413 bits (851), Expect = 1.431e-90
Identity = 165/208 (79.33%), Postives = 182/208 (87.50%), Query Frame = 3
Query:   84 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKE KTHIN+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD T  ++S+ R++EI+KE  +++KKVGYNP  V FVP SGF GDNM+E STN
Sbjct:    1 MGKEDKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTT--QWSQTRFEEIIKETKNFIKKVGYNPAGVAFVPISGFNGDNMLEPSTN 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_SCHCO (Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 1.869e-90
Identity = 163/208 (78.37%), Postives = 181/208 (87.02%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK H+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KY  TVIDAPGHRDFIKNMITGTSQADCA+L I   TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T  K+S+ R++EIVKE S+++KKVGYNP+ V FVP SG+ GDNM+E STN+
Sbjct:    1 MGKEKLHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILTIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--KWSEDRFNEIVKETSTFIKKVGYNPKTVAFVPISGWHGDNMLEESTNM 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_HYDAT (Elongation factor 1-alpha OS=Hydra attenuata PE=2 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 3.188e-90
Identity = 162/206 (78.64%), Postives = 181/206 (87.86%), Query Frame = 3
Query:   90 KEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            K K HINIVVIGHVDSGKST+TGH+IYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFETTKY  T+IDAPGHRDFIKNMITGTSQADCAVLI+ S+TG FEAGISK+GQTREHALLAFTLGVKQMI   NK+D T P YS+AR++EI KE+S+Y+KKVGY+P+ VP +P SG+ GDNMIE S N+
Sbjct:    4 KVKPHINIVVIGHVDSGKSTSTGHMIYKCGGIDKRQIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKYVVTIIDAPGHRDFIKNMITGTSQADCAVLIVASSTGEFEAGISKNGQTREHALLAFTLGVKQMIVAVNKIDNTEPPYSEARFNEIKKEISAYVKKVGYDPKTVPVLPVSGWHGDNMIEPSPNM 209          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_CRYNE (Elongation factor 1-alpha OS=Cryptococcus neoformans GN=TEF1 PE=2 SV=2)

HSP 1 Score: 331.257 bits (848), Expect = 3.188e-90
Identity = 160/208 (76.92%), Postives = 182/208 (87.50%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGK+K H+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE  E+ K SFKYAWVLDKLKAERERGITIDIALWKFET +Y  TVIDAPGHRDFIKNMITGTSQADCA+LII +  G FEAGISKDGQTREHALLAFTLGV+Q+I  CNKMD  T K+S+ R++EIVKE + ++KKVGYNP+ VPFVP SG+ GDNM+E +TN+
Sbjct:    1 MGKDKLHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQELGKSSFKYAWVLDKLKAERERGITIDIALWKFETPRYQVTVIDAPGHRDFIKNMITGTSQADCAILIIATGIGEFEAGISKDGQTREHALLAFTLGVRQLIVACNKMD--TCKWSEDRFNEIVKETNGFIKKVGYNPKAVPFVPISGWHGDNMLEETTNM 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PIRIN (Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 4.164e-90
Identity = 163/208 (78.37%), Postives = 181/208 (87.02%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK H+N+VVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWK ET KY  TVIDAPGHRDFIKNMITGTSQADCA+LII   TG FEAGISKDGQTREHALLAFTLGV+Q+I   NKMD T   +S+AR++EIVKE S+++KKVGYNP+ V FVP SG+ GDNM+E STN+
Sbjct:    1 MGKEKAHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKSETPKYMVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDTT--NWSEARFNEIVKETSNFIKKVGYNPKTVAFVPISGWHGDNMLEPSTNM 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ENTHI (Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 5.438e-90
Identity = 162/208 (77.88%), Postives = 183/208 (87.98%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M KEKTHINIVVIGHVDSGKSTTTGHLIYK GGID+R IE+FEKE AEM K SFKYAWVLD LKAERERGITIDI+LWKFET+KYY T+IDAPGHRDFIKNMITGTSQAD A+LI+ + TG FEAGISK+GQTREH LL++TLGVKQMI   NKMDA   +Y + RY+EI KE+S++LKK GYNP+K+PFVP SGF+GDNMIE STN+
Sbjct:    1 MPKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDQRTIEKFEKESAEMGKGSFKYAWVLDNLKAERERGITIDISLWKFETSKYYFTIIDAPGHRDFIKNMITGTSQADVAILIVAAGTGEFEAGISKNGQTREHILLSYTLGVKQMIVGVNKMDAI--QYKQERYEEIKKEISAFLKKTGYNPDKIPFVPISGFQGDNMIEPSTNM 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_TRIRE (Elongation factor 1-alpha OS=Trichoderma reesei GN=tef1 PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 7.103e-90
Identity = 164/208 (78.85%), Postives = 182/208 (87.50%), Query Frame = 3
Query:   84 MGKE-KTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTN 704
            MGKE KTHIN+VVIGHVDSGKSTTTGHLIY+ GGIDKR IE+FEKE AE+ K SFKYAWVLDKLKAERERGITIDIALWKFET KYY TVIDAPGHRDFIKNMITGTSQADCA+LII + TG FEAGISKDGQTREHALLA+TLGVKQ+I   NKMD  T  +++ARY EI+KE S+++KKVG+NP+ V FVP SGF GDNM+  STN
Sbjct:    1 MGKEDKTHINVVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMD--TANWAEARYQEIIKETSNFIKKVGFNPKAVAFVPISGFNGDNMLTPSTN 206          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_EUPCR (Elongation factor 1-alpha 1 OS=Euplotes crassus GN=EFA1 PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.582e-89
Identity = 161/208 (77.40%), Postives = 180/208 (86.54%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK H+N+VVIGHVDSGKSTTTGHLIYKLGGID R IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDIALWKFET   + T+IDAPGHRDFIKNMITGTSQAD A+LII S TG FEAGISK+GQTREHALLA+T+GVKQM+   NKMD+T P YS+ RY+EI KEVS++L KVGY P K+ FVP SGF+GDN+ E STN+
Sbjct:    1 MGKEKEHLNLVVIGHVDSGKSTTTGHLIYKLGGIDARTIEKFEKESAEMGKASFKYAWVLDKLKAERERGITIDIALWKFETENRHYTIIDAPGHRDFIKNMITGTSQADAAILIIASGTGEFEAGISKEGQTREHALLAYTMGVKQMVVAMNKMDSTEPPYSEDRYEEIKKEVSTFLAKVGYKPAKMNFVPISGFQGDNIQENSTNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1AC_PORPU (Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 2.285e-88
Identity = 159/205 (77.56%), Postives = 176/205 (85.85%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            MGKEK H++IVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDIALWKFET KY  T+IDAPGHRDFIKNMITGTSQAD A+L+I S  G FEAGIS++GQTREHALLA+TLGVKQMI  CNKMD     +SK RY+E+ KE+  YLKKVGYNP KVP VPTSG+ G+N+ ER+
Sbjct:    1 MGKEKQHVSIVVIGHVDSGKSTTTGHLIYKCGGIDKRAIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETDKYNFTIIDAPGHRDFIKNMITGTSQADLAILVIASPPGEFEAGISQNGQTREHALLAYTLGVKQMIVACNKMDDKNVNWSKERYEEVSKEMDLYLKKVGYNPPKVPKVPTSGWTGENLFERT 205          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_YEAST1.431e-9078.74Elongation factor 1-alpha OS=Saccharomyces cerevis... [more]
EF1A_NEUCR1.431e-9079.33Elongation factor 1-alpha OS=Neurospora crassa GN=... [more]
EF1A_SCHCO1.869e-9078.37Elongation factor 1-alpha OS=Schizophyllum commune... [more]
EF1A_HYDAT3.188e-9078.64Elongation factor 1-alpha OS=Hydra attenuata PE=2 ... [more]
EF1A_CRYNE3.188e-9076.92Elongation factor 1-alpha OS=Cryptococcus neoforma... [more]
EF1A_PIRIN4.164e-9078.37Elongation factor 1-alpha OS=Piriformospora indica... [more]
EF1A_ENTHI5.438e-9077.88Elongation factor 1-alpha OS=Entamoeba histolytica... [more]
EF1A_TRIRE7.103e-9078.85Elongation factor 1-alpha OS=Trichoderma reesei GN... [more]
EF1A1_EUPCR1.582e-8977.40Elongation factor 1-alpha 1 OS=Euplotes crassus GN... [more]
EF1AC_PORPU2.285e-8877.56Elongation factor 1-alpha C OS=Porphyra purpurea G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top