FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PORYE (Elongation factor 1-alpha OS=Porphyra yezoensis PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.526e-87
Identity = 157/205 (76.59%), Postives = 176/205 (85.85%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            MGKEK H++IVVIGHVDSGKSTTTGHLIYK GGI+KR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDIALWKFET KY  T+IDAPGHRDFIKNMITGTSQAD A+L+I S  G FEAGIS++GQTREHALLA+TLGVKQMI  CNKMD     +S+ RY+E+ KE+  YLKKVGYNP KVP VPTSG+ G+N+ ER+
Sbjct:    1 MGKEKQHVSIVVIGHVDSGKSTTTGHLIYKCGGIEKRAIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETEKYSFTIIDAPGHRDFIKNMITGTSQADLAILVIASPPGEFEAGISQNGQTREHALLAYTLGVKQMIVACNKMDDKNVNWSQDRYEEVSKEMDLYLKKVGYNPAKVPKVPTSGWTGENLFERT 205          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_PLAFK (Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 9.600e-87
Identity = 155/205 (75.61%), Postives = 177/205 (86.34%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERS 698
            MGKEKTHIN+VVIGHVDSGKSTTTGH+IYKLGGID+R IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDIALWKFET +Y+ TVIDAPGH+DFIKNMITGTSQAD A+L++ +  GGF+   SK+GQT+EH LLAFTLGVKQ++   NKMD  T KYS+ RY+EI KEV  YLKKVGY  +KV F+P SGFEGDN+IE+S
Sbjct:    1 MGKEKTHINLVVIGHVDSGKSTTTGHIIYKLGGIDRRTIEKFEKESAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETPRYFFTVIDAPGHKDFIKNMITGTSQADVALLVVPADVGGFDGAFSKEGQTKEHVLLAFTLGVKQIVVGVNKMD--TVKYSEDRYEEIKKEVKDYLKKVGYQADKVDFIPISGFEGDNLIEKS 203          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_SPOFR (Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.764e-86
Identity = 154/194 (79.38%), Postives = 170/194 (87.63%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E ST +
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKM 194          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_HELZE (Elongation factor 1-alpha (Fragment) OS=Heliothis zea PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.764e-86
Identity = 154/194 (79.38%), Postives = 170/194 (87.63%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E ST +
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKM 194          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_HELVI (Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.764e-86
Identity = 154/194 (79.38%), Postives = 170/194 (87.63%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E ST +
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKM 194          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_HELGL (Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.764e-86
Identity = 154/194 (79.38%), Postives = 170/194 (87.63%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E ST +
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKM 194          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_HELDI (Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.764e-86
Identity = 154/194 (79.38%), Postives = 170/194 (87.63%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E ST +
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKM 194          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_HELAM (Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.764e-86
Identity = 154/194 (79.38%), Postives = 170/194 (87.63%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E ST +
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKM 194          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_HELAL (Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.764e-86
Identity = 154/194 (79.38%), Postives = 170/194 (87.63%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E ST +
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKM 194          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ANIIF (Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.764e-86
Identity = 154/194 (79.38%), Postives = 170/194 (87.63%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E ST +
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKM 194          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_PORYE2.526e-8776.59Elongation factor 1-alpha OS=Porphyra yezoensis PE... [more]
EF1A_PLAFK9.600e-8775.61Elongation factor 1-alpha OS=Plasmodium falciparum... [more]
EF1A_SPOFR4.764e-8679.38Elongation factor 1-alpha (Fragment) OS=Spodoptera... [more]
EF1A_HELZE4.764e-8679.38Elongation factor 1-alpha (Fragment) OS=Heliothis ... [more]
EF1A_HELVI4.764e-8679.38Elongation factor 1-alpha (Fragment) OS=Heliothis ... [more]
EF1A_HELGL4.764e-8679.38Elongation factor 1-alpha (Fragment) OS=Helicoverp... [more]
EF1A_HELDI4.764e-8679.38Elongation factor 1-alpha (Fragment) OS=Heliocheil... [more]
EF1A_HELAM4.764e-8679.38Elongation factor 1-alpha (Fragment) OS=Helicoverp... [more]
EF1A_HELAL4.764e-8679.38Elongation factor 1-alpha (Fragment) OS=Heliocheil... [more]
EF1A_ANIIF4.764e-8679.38Elongation factor 1-alpha (Fragment) OS=Anicla inf... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top