FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ADIBE (Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.764e-86
Identity = 154/194 (79.38%), Postives = 170/194 (87.63%), Query Frame = 3
Query:  126 HVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            HVDSGKSTTTGHLIYK GGIDKR IE+FEKE  EM K SFKYAWVLDKLKAERERGITIDIALWKFET KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FEAGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS++R++EI KEVSSY+KK+GYNP  V FVP SG+ GDNM+E ST +
Sbjct:    1 HVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSESRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEASTKM 194          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_CRYPV (Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 3.088e-85
Identity = 158/208 (75.96%), Postives = 176/208 (84.62%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHIN+VVIGHVDSGKSTTTGHLIYKLGGIDKR IE+FEKE +EM K SFKYAWVLDKLKAERERGITIDIALW+FET KY+ TVIDAPGHRDFIKNMITGTSQAD A+L++ +    FE   SK+GQTREHALLAFTLGV+QMI   NKMD  T +Y ++R+DEI  EV  YLKKVGYN EK+PFV  SGF GDNM+ERS  +
Sbjct:    1 MGKEKTHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKESSEMGKGSFKYAWVLDKLKAERERGITIDIALWQFETPKYHYTVIDAPGHRDFIKNMITGTSQADVALLVVPADR--FEGAFSKEGQTREHALLAFTLGVRQMIVGINKMD--TCEYKQSRFDEIFNEVDGYLKKVGYNTEKIPFVAISGFVGDNMVERSDKM 204          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_STYLE (Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 4.930e-83
Identity = 151/208 (72.60%), Postives = 171/208 (82.21%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M KEK H+N+VVIGHVDSGKST+TGHLIYK GGIDKR IE+FEKE AEM K SFKYAWVLDKLKAERERGITIDIALW FET K   T+IDAPGHRDFIKNMITGTSQAD A+LII S  G FEAGISK+GQTREHALLAFT+GVKQMI   NKMD  +  + + R+ EI KE+S YLKK+   P + PF+P SG+ GDNM+E+S N+
Sbjct:    1 MPKEKNHLNLVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWNFETAKSVFTIIDAPGHRDFIKNMITGTSQADAAILIIASGQGEFEAGISKEGQTREHALLAFTMGVKQMIVAVNKMDDKSVNWDQGRFIEIKKELSDYLKKIWLQPRQDPFIPISGWHGDNMLEKSPNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_BLAHO (Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 2.071e-81
Identity = 151/210 (71.90%), Postives = 171/210 (81.43%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYN--PEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HIN+VVIGHV +GKSTTTGHLIY  GGIDKR IERFE+    + K SFKYAWVL K+KAERERGITIDI+LWKFET K + T+IDAPGHRDFIKNMITGTSQAD A+L+I S  G FEAG SK+GQTREHALLA TLGVKQMI CCNKMD  +  YS+ARY EI  E++S+L KVGY    E++PF+P SGF GDNMIE S N+
Sbjct:    1 MGKEKPHINLVVIGHVVAGKSTTTGHLIYACGGIDKRTIERFEEGGQRIGKGSFKYAWVLAKMKAERERGITIDISLWKFETRKDFFTIIDAPGHRDFIKNMITGTSQADVAILVIASGAGEFEAGYSKNGQTREHALLANTLGVKQMIVCCNKMDDKSVNYSEARYKEIKNEMTSFLTKVGYAKVEERIPFIPISGFNGDNMIEHSANM 210          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_XENLA (Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2)

HSP 1 Score: 300.442 bits (768), Expect = 6.027e-81
Identity = 137/211 (64.93%), Postives = 171/211 (81.04%), Query Frame = 3
Query:   75 LTAMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            +T    +KTH+NIV+IGHVDSGKSTTTGHLIYK GG D R +E+ E   A++ K SFK+AW+LDKLKAERERGITIDI+LWKF+T ++  T+IDAPGHRDFIKNMITGTSQAD A+L++ + TG FEAG+S++GQTREHALLA+T+GVKQ+I C NKMD T P YS  R+DE+V+ V  YLKK+GYNP  +PFVP SG+ G+N+   S  +
Sbjct:    1 MTDKAPQKTHLNIVIIGHVDSGKSTTTGHLIYKCGGFDPRALEKVEAAAAQLGKSSFKFAWILDKLKAERERGITIDISLWKFQTNRFTITIIDAPGHRDFIKNMITGTSQADVALLVVSAATGEFEAGVSRNGQTREHALLAYTMGVKQLIVCVNKMDLTDPPYSHKRFDEVVRNVMVYLKKIGYNPATIPFVPVSGWTGENISSPSQKM 211          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_HYPBU (Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403) GN=tuf PE=3 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 4.329e-71
Identity = 120/208 (57.69%), Postives = 161/208 (77.40%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            M ++K HIN+VVIGHVD GKST  GHL+Y+LG +D++ I+  E+E  +  K SFKYAW+LD+LK ERERG+TID+   KFET KYY T+IDAPGHRDF+KNMITG SQAD A+L++ +  G FEAG+S +GQTREH +LA T+G+ Q+I   NKMDAT P YSK RY++IV  +  ++K +GY  +++PF+P S + G+N+IERS N+
Sbjct:    1 MSQQKPHINLVVIGHVDHGKSTLVGHLLYRLGFVDEKTIKMLEEEAKKKGKESFKYAWLLDRLKEERERGVTIDLTFVKFETKKYYFTIIDAPGHRDFVKNMITGASQADAAILVVSARRGEFEAGMSAEGQTREHLILAKTMGIDQLIVAVNKMDATEPPYSKQRYEQIVAFLKKFMKSLGYKVDQIPFIPVSAWTGENLIERSPNM 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1AS_PORPU (Elongation factor 1-alpha S OS=Porphyra purpurea GN=TEF-S PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 5.654e-71
Identity = 141/238 (59.24%), Postives = 166/238 (69.75%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPK----YSKARYDEIVKEVSSYLKKVGYNPE--------------------------KVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHIN+VVIGHVD+GKSTTTGHLIYKLGGID R I +FE +  EM K SFKYAWVLDKLKAERERGITIDIALWKF T K+  TVIDAPGHRDFIKNMITGTSQAD A+L+ID     FEAGI++ G T+EHALLA+TLGVKQ+    NKMD    K    +++ RY+E+V  +   L K+G+  +                             FVP SG+ GDNM+E+STN+
Sbjct:    1 MGKEKTHINLVVIGHVDAGKSTTTGHLIYKLGGIDARTIAKFEADAKEMGKSSFKYAWVLDKLKAERERGITIDIALWKFSTAKFEYTVIDAPGHRDFIKNMITGTSQADVALLVIDG--NNFEAGIAEGGSTKEHALLAYTLGVKQLAVGINKMDDVKDKDGGPWAQGRYNEVVDYLGPELMKIGFKKKDKGDKKKGDKKEKKDKKDKGEKKYVCSATFVPISGWTGDNMLEKSTNM 236          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A2_EUPCR (Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.645e-70
Identity = 130/206 (63.11%), Postives = 164/206 (79.61%), Query Frame = 3
Query:   90 KEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            KEK H+N+VVIGHVDSGKSTTTGHLIYKLGGID+R + + E++  E+NK SFKYA+VLD LKAE+ERGITI+ AL +F+T     T+IDAPGH+DFIKNMITGTSQAD AVLII +  G FE G S++G T++HALLA+T+G+KQ I   NKMD  T  Y + R++EIV+ VS +L K+GY  E V ++P SGF+GDNM+E+S NL
Sbjct:    4 KEKDHLNLVVIGHVDSGKSTTTGHLIYKLGGIDERTLAKLEEKALELNKASFKYAFVLDNLKAEQERGITINCALRQFDTPSRSYTIIDAPGHKDFIKNMITGTSQADAAVLIIAAKKGEFEDGFSREGSTKDHALLAYTMGIKQAIVAINKMD--TIDYDEERFNEIVENVSDHLGKIGYKKENVKYIPISGFDGDNMLEQSENL 207          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_IGNH4 (Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.066e-69
Identity = 119/206 (57.77%), Postives = 160/206 (77.67%), Query Frame = 3
Query:   90 KEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            KEK H+N++VIGHVD GKST  GHL+Y+LG +D++ ++  E+E  +  K SFKYAW+LDKLK ERERG+TID+   KFET KYY T+IDAPGHRDFIKNMITG SQAD A+L++ +  G FEAG+S +GQTREH LLA T+G+ Q+I   NKMDAT P +S+ RY +IV+ +  ++K +G+  +++PFVP S + GDN+I+RS N+
Sbjct:    4 KEKPHMNLIVIGHVDHGKSTLVGHLLYELGFVDEKTLKMLEEEAKKRGKESFKYAWLLDKLKEERERGVTIDLTFMKFETPKYYFTIIDAPGHRDFIKNMITGASQADAAILVVSARPGEFEAGMSAEGQTREHILLAKTMGIDQIIVAVNKMDATEPPWSEKRYKQIVETLKKFMKGLGFKVDEIPFVPVSAWTGDNIIKRSENM 209          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_DESMO (Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 3.102e-69
Identity = 116/205 (56.59%), Postives = 161/205 (78.54%), Query Frame = 3
Query:   93 EKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            +K H+NIV+IGHVD GKST TGH++Y+LG  D++ ++  E+E  +M K SFK+AW+LD++K ERERG+TI ++  KFET KY+ T+IDAPGHRDF+KNMITG SQAD A+L++ +  G FEAG+S +GQTREHA+LA T+G+ Q+I   NKMDAT P YS+ RY+EI + +  +LK +GY+  K+PF+P S + G+N+IERS N+
Sbjct:    5 QKPHLNIVIIGHVDHGKSTMTGHILYRLGYFDEKTVKMIEEESKKMGKESFKFAWLLDRMKEERERGVTISLSYMKFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSARKGEFEAGMSAEGQTREHAILARTMGINQLIVAINKMDATEPPYSEKRYNEIKEILGKFLKGLGYDVSKIPFIPISAWTGENLIERSPNM 209          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ADIBE4.764e-8679.38Elongation factor 1-alpha (Fragment) OS=Adisura be... [more]
EF1A_CRYPV3.088e-8575.96Elongation factor 1-alpha OS=Cryptosporidium parvu... [more]
EF1A_STYLE4.930e-8372.60Elongation factor 1-alpha OS=Stylonychia lemnae GN... [more]
EF1A_BLAHO2.071e-8171.90Elongation factor 1-alpha OS=Blastocystis hominis ... [more]
EF1A1_XENLA6.027e-8164.93Elongation factor 1-alpha OS=Xenopus laevis PE=1 S... [more]
EF1A_HYPBU4.329e-7157.69Elongation factor 1-alpha OS=Hyperthermus butylicu... [more]
EF1AS_PORPU5.654e-7159.24Elongation factor 1-alpha S OS=Porphyra purpurea G... [more]
EF1A2_EUPCR1.645e-7063.11Elongation factor 1-alpha 2 OS=Euplotes crassus GN... [more]
EF1A_IGNH41.066e-6957.77Elongation factor 1-alpha OS=Ignicoccus hospitalis... [more]
EF1A_DESMO3.102e-6956.59Elongation factor 1-alpha OS=Desulfurococcus mobil... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top