FC876209

Overview
NameFC876209
Unique NameFC876209
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length667
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10894 contig Ccv1_Contig10894:38..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71AD_ARATH (Cytochrome P450 71A13 OS=Arabidopsis thaliana GN=CYP71A13 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.320e-22
Identity = 64/190 (33.68%), Postives = 108/190 (56.84%), Query Frame = 2
Query:   95 SLALYLPIFLALYVLTKQFLNKIR---RLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIESVDLRMEIY-DLTMNVMMRMIAGKRY 652
            S++L L   + L +L ++FL +      LPPSP+  LP+IG+L+ L    HR+L +LS R+GP++LL FG   +LVVSS  AA+E    +D  FANRP       +      + +APYG++WR ++ V  L +L++  ++    +R DEV +++ +L       S +   E++  L  +V  R+  G+++
Sbjct:    6 SISLCLTTLITLLLL-RRFLKRTATKVNLPPSPW-RLPVIGNLHQLSLHPHRSLRSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDHKFANRPRSKAVHGLMNGGRDVVFAPYGEYWRQMKSVCILNLLTNKMVESFEKVREDEVNAMIEKLEKASSSSSSENLSELFITLPSDVTSRVALGRKH 193          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71AN_ARATH (Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.336e-22
Identity = 60/183 (32.79%), Postives = 105/183 (57.38%), Query Frame = 2
Query:  104 LYLPIFLALYVLTKQFLNKIRRLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIESVDLRMEIYDLTMNVMMRMIAGKRY 652
            + L I   L+    + +NKI   P  P   LP+IG+L+ L +  HR+L  LS R+GP++LL FGS  V+V S+  AA +    +D VFA+RP   + + +     ++A APYG++WR ++ V+ L +LS+  ++   ++R +E+ +L+         + V+L   +  LT +V+ R+  G++Y
Sbjct:    8 IILFIITILFFKKHKTVNKIINFPSPP--RLPLIGNLHQLSQHPHRSLCYLSHRYGPLMLLHFGSVPVIVASTAEAARDVLKTHDRVFASRPRSKIFEKLLYKSRNMASAPYGEYWRQMKSVSVLHLLSNKMVRSFQDVRQEEI-TLMMETIRKSSSKPVNLSKILSSLTNDVICRVALGRKY 187          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71AC_ARATH (Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.336e-22
Identity = 65/190 (34.21%), Postives = 109/190 (57.37%), Query Frame = 2
Query:   98 LALYLPIFLALYVLTKQFL----NKIRRLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIESVDLRMEIY-DLTMNVMMRMIAGKRY 652
            ++L L   + L++L KQFL    NK+  LPPSP+  LP+IG+L+ L    HR+L +LS R+GP++LL FG   +LVVSS  AA+E    +D+ FANRP       +      + + PYG++WR ++ V  L +L++  +     IR +E+  ++++L       S +   E++  L  +V  R+  G+++
Sbjct:    7 VSLCLTTLITLFLL-KQFLKRTANKVN-LPPSPW-RLPLIGNLHQLSLHPHRSLHSLSLRYGPLMLLHFGRVPILVVSSGEAAQEVLKTHDLKFANRPRSKAVHGLMNGGRDVVFGPYGEYWRQMKSVCILNLLTNKMVASFEKIREEELNEMIKKLEKASSSSSSENLSELFVTLPSDVTSRIALGRKH 193          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71BY_ARATH (Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=2 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 5.663e-22
Identity = 64/189 (33.86%), Postives = 110/189 (58.20%), Query Frame = 2
Query:  107 YLPI-FLALYVLTKQFLNKIR---RLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIES-VDLRMEIYDLTMNVMMRMIAGKRYYG 658
            +LP+ FL+  +L    L K R   R PPSP    PIIG+L+ L    H++L +LSK++GP++LL+FGS   +VVSS   A++    +D+   +RPSL   + +  N+  + ++P+ D+W+ LRR+   E+ S  ++ L+  IR +EVK L+     +   ++ V+L  ++  LT+ V+ +   G  + G
Sbjct:    6 FLPLLFLSCLLLAALRLKKRRQHQRKPPSP-PGFPIIGNLHQLGELPHQSLWSLSKKYGPVMLLKFGSIPTVVVSSSETAKQALKIHDLNCCSRPSLAGPRALSYNYLDIVFSPFNDYWKELRRMCVQELFSPKQVHLIQPIREEEVKKLMNSFSESAAQKTPVNLSEKLASLTVGVICKAAFGVSFQG 193          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71BK_ARATH (Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 5.663e-22
Identity = 60/174 (34.48%), Postives = 101/174 (58.05%), Query Frame = 2
Query:  149 FLNKIRRL----PPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIES-VDLRMEIYDLTMNVMMRMIAGKRYY 655
            F  KI+ L    PPSP  + P+IG+L+ +    HR+L +L++R+GP++LL FG   V VVSS  AAEE    +D+   +RP L+  + +  NF  + + PYG+ W+  R+ A  E+    ++Q   +IR +E   LV++L  + +  S VDL   ++ LT ++  R+  G+ ++
Sbjct:   19 FAKKIKHLKWNLPPSP-PKFPVIGNLHQIGELPHRSLQHLAERYGPVMLLHFGFVPVTVVSSREAAEEVLRTHDLDCCSRPKLVGTRLLSRNFKDVCFTPYGNEWKARRKFALRELFCLKKVQSFRHIREEECNFLVKQLSESAVNRSPVDLSKSLFWLTASIFFRVALGQNFH 191          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71DA_SOYBN (Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.262e-21
Identity = 55/186 (29.57%), Postives = 107/186 (57.53%), Query Frame = 2
Query:  116 IFLALYVLTKQFLNKIR---RLPPSPFLELPIIGHLYLL--KRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIES---VDLRMEIYDLTMNVMMRMIAGKR 649
            IF   + L ++  +K     +LPP P   LP+IG+++ +    P+H  L NL+ ++GP++ L+ G    ++V+SP  A+E    +D+ F++RP  ++ + +  N + + ++ +GD+WR LR++ ++E+L++ R+Q   +IR +EV  LV+++      E     +L   IY +T  +  R   GK+
Sbjct:   22 IFFVFFKLVQRSDSKTSSTCKLPPGP-RTLPLIGNIHQIVGSLPVHYYLKNLADKYGPLMHLKLGEVSNIIVTSPEMAQEIMKTHDLNFSDRPDFVLSRIVSYNGSGIVFSQHGDYWRQLRKICTVELLTAKRVQSFRSIREEEVAELVKKIAATASEEGGSIFNLTQSIYSMTFGIAARAAFGKK 206          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71B9_ARATH (Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3)

HSP 1 Score: 103.219 bits (256), Expect = 1.262e-21
Identity = 61/180 (33.89%), Postives = 104/180 (57.78%), Query Frame = 2
Query:  107 YLPIFLALYVLTKQFLNKIRRL----PPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIES-VDLRMEIYDLTMNVMMR 631
            +L +     +L   F +K RR     PPSP    PIIG+L+ L    H++L +LSK +GP++LL+ GS   +VVSS   A++    ND+   +RPSL   K +  N+  +A++P+ D+W+ LRR+   E+ S+ R+  +  I+ +EV+ L+     +   +S V+L  +  DLT++V+ +
Sbjct:    6 FLSLLFLCCILLAAFKHKKRRTNQQQPPSP-PGFPIIGNLHQLGELPHQSLWSLSKTYGPVMLLKLGSVPTVVVSSSETAKQVLKINDLHCCSRPSLAGAKELSYNYLDIAFSPFDDYWKELRRICVQELFSAKRVHSIQPIKEEEVRKLIVSATESASQKSPVNLSEKFLDLTVSVICK 184          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71AQ_ARATH (Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.648e-21
Identity = 61/180 (33.89%), Postives = 102/180 (56.67%), Query Frame = 2
Query:  122 LALYVLTKQFLNKIRRLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIESVDLRMEIYDLTMNVMMRMIAGKRYYGK 661
            + + +  KQ   K R   PSP   LP+IG+L+ L R  HR+L +LS R+GP++LL FG   VLVVSS   A +    +D VFA+RP   + + +  +   +A APYG++WR ++ V  L + S+  ++    +R +E+ SL+       +   V+L   +  LT +V+ ++  G++Y G+
Sbjct:   15 VTIIIFRKQKRGKKRNTLPSP-PGLPLIGNLHQLGRHPHRSLCSLSHRYGPLMLLHFGRVPVLVVSSAELARDVLKTHDRVFASRPRSKIFEKLLYDKHDVASAPYGEYWRQMKSVCVLHLFSNKMVRSFREVREEEI-SLMMEKIRKSISLPVNLSKILVSLTNDVICKVALGRKYGGE 192          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71D7_SOLCH (Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.152e-21
Identity = 57/157 (36.31%), Postives = 102/157 (64.97%), Query Frame = 2
Query:   89 MKSLALYLPI-FLALYVLTKQFLN--KIRRLPPSPFLELPIIGHLYLLKRPI-HRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLV 547
            M+ ++++L I FL L    K++LN  + ++LPP P+ +LP IG ++ L   + HR L +L++++GP++ L+ G    +VV+SP  A++    +DI FA+RP L+    +  N   +A++PYGD+WR +R++  +E+LS+  ++  S+IR DEV  L+
Sbjct:    1 MQLVSIFLFISFLFLLRKWKKYLNNSQTKKLPPGPW-KLPFIGGMHHLAGGLPHRVLRDLAEKYGPLMHLQLGEVSAVVVTSPEMAKQVLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGDYWRQMRKICIMEVLSAKSVRSFSSIRHDEVVRLI 156          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71BQ_ARATH (Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.152e-21
Identity = 57/186 (30.65%), Postives = 106/186 (56.99%), Query Frame = 2
Query:  104 LYLPIFLALYVLTKQFLNKIRRLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIES-VDLRMEIYDLTMNVMMRMIAGKRYYG 658
            L+  IFL L    ++   K RR+P  P    PIIG+L+ L    H++L  LSK++GP++LL+ G    L++SS   A++     D+   +RPSL  G+ +  N   ++ +PY ++W+ LR++ S E+ S++++Q +  I+ +EVK ++  +  +  +++ V+L      LT +V+ +   G  + G
Sbjct:   10 LFFIIFLLLAAFKRKNHGKHRRIPSPP--GFPIIGNLHQLGELQHQSLWKLSKKYGPVMLLKLGKVPTLILSSSETAKQALRDYDLHCCSRPSLAGGRELSYNNLDMSSSPYNEYWKELRKLCSQELFSANKIQSIQPIKDEEVKKVIDSIAESSSLKNPVNLSKTFLALTTSVVCKAAFGVSFEG 193          
The following BLAST results are available for this feature:
BLAST of FC876209 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 135
Match NameE-valueIdentityDescription
C71AD_ARATH3.320e-2233.68Cytochrome P450 71A13 OS=Arabidopsis thaliana GN=C... [more]
C71AN_ARATH4.336e-2232.79Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=C... [more]
C71AC_ARATH4.336e-2234.21Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=C... [more]
C71BY_ARATH5.663e-2233.86Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=C... [more]
C71BK_ARATH5.663e-2234.48Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=C... [more]
C71DA_SOYBN1.262e-2129.57Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 P... [more]
C71B9_ARATH1.262e-2133.89Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CY... [more]
C71AQ_ARATH1.648e-2133.89Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=C... [more]
C71D7_SOLCH2.152e-2136.31Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71... [more]
C71BQ_ARATH2.152e-2130.65Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G02EF DevOvary1 Citrus clementina cDNA clone C32001G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876209 ID=FC876209|Name=FC876209|organism=Citrus clementina|type=EST|length=667bp
GGAAAAAGGAGTGAGGCAATGCCCCCGATCTGAATTAAAGGTTCTCTCTC
ATGTTTCTTGGGCATAGCTAGCAGCCATACATACATCAATGAAGAGCTTG
GCTCTCTACTTGCCCATATTTCTGGCACTGTATGTCCTCACAAAGCAATT
TTTAAACAAAATCAGACGCCTCCCACCAAGTCCATTTCTTGAGCTACCCA
TAATTGGACATCTCTACCTCCTCAAGCGACCAATTCATAGAACACTATCC
AATTTATCAAAACGACACGGTCCCATTCTCCTCCTCCGATTCGGTTCTCG
CCGTGTCCTTGTTGTCTCATCACCACCAGCAGCCGAAGAATGCTTCACTA
AAAACGACATCGTCTTCGCCAACCGCCCTTCCTTGATGGTCGGCAAACAC
ATGGGTTGCAACTTCACGAGCCTCGCCTGGGCCCCATACGGCGACCACTG
GAGAAACCTTAGACGAGTCGCCTCGCTCGAAATTCTGTCCTCTTCTCGCC
TCCAACTCTTATCTAATATTCGCGCTGATGAGGTCAAATCTTTGGTCCGC
CGTCTCTTTCACAATCAATTGATCGAATCCGTTGACTTGAGGATGGAGAT
TTATGATCTCACAATGAATGTCATGATGAGGATGATCGCTGGAAAGAGAT
ATTACGGCAAACACGTG
back to top