FC876211

Overview
NameFC876211
Unique NameFC876211
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig108 contig Ccv1_Contig108:371..1098. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 1.581e-100
Identity = 177/214 (82.71%), Postives = 193/214 (90.19%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA STMALSS +F GKAV L+P  +E+   GR++MRKT   +  SGSPWYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DPEAFAEL++++
Sbjct:    1 MAASTMALSSPAFAGKAVKLSPGASEVFGTGRVTMRKTVKPTGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE 214          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB21_MAIZE (Chlorophyll a-b binding protein 1, chloroplastic OS=Zea mays GN=CAB1 PE=3 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 6.009e-100
Identity = 179/215 (83.26%), Postives = 191/215 (88.84%), Query Frame = 3
Query:   54 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA STMA+SS+   G  + +   G      GRI+MRKT  K    +SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAEL++++
Sbjct:    1 MAASTMAISSTAMAGTPIKVGSFGE-----GRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE 210          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB22_HORVU (Chlorophyll a-b binding protein 2, chloroplastic OS=Hordeum vulgare GN=CAB2 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.025e-99
Identity = 177/213 (83.10%), Postives = 189/213 (88.73%), Query Frame = 3
Query:   54 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA +TMALSSS F GKAV    S +E+    R+SMRKT +     GSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFK G+QIFSEGGL YLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADD EAFAEL++++
Sbjct:    1 MAAATMALSSSTFAGKAVKNLSSSSEVQGDARVSMRKTAATK-KVGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLGALGCVFPELLARNGVKFGEAVWFKKGSQIFSEGGLQYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDAEAFAELKVKE 212          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.480e-98
Identity = 179/217 (82.49%), Postives = 192/217 (88.48%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLA--PSGNELSNGGRISMRK--TGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA S+MALSS +  GK V  +  PS  EL  G R +MRK  T  K  SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAEL++++
Sbjct:    1 MAASSMALSSPTLTGKPVETSANPSSQELG-GARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE 216          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB21_WHEAT (Chlorophyll a-b binding protein, chloroplastic OS=Triticum aestivum GN=WHAB1.6 PE=3 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.480e-98
Identity = 175/215 (81.40%), Postives = 193/215 (89.77%), Query Frame = 3
Query:   54 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA +TM+LSSS F GKAV   PS + L    R++MRKT +K+  VSS SPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEA WFKAG+QIFS+GGLDYLGNPSL+HAQS+LAIWACQVVLMGAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+ P+AFAEL++++
Sbjct:    1 MAATTMSLSSSSFAGKAVKNLPS-SALIGDARVNMRKTAAKAKQVSSSSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAGWFKAGSQIFSDGGLDYLGNPSLVHAQSLLAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLAERPQAFAELKVKE 214          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB21_ARATH (Chlorophyll a-b binding protein 165/180, chloroplastic OS=Arabidopsis thaliana GN=LHCP-A PE=1 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.480e-98
Identity = 176/215 (81.86%), Postives = 194/215 (90.23%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVS-SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA STMALSS +F GKAVNL+P+ +E+   GR++MRKT +K    SGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DPEAFAEL++++
Sbjct:    1 MAASTMALSSPAFAGKAVNLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE 215          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB22_PEA (Chlorophyll a-b binding protein AB80, chloroplastic OS=Pisum sativum GN=AB80 PE=1 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 1.933e-98
Identity = 176/214 (82.24%), Postives = 191/214 (89.25%), Query Frame = 3
Query:   57 ATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRK--TGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            ++S+MALSS +  GK + L PS  EL    R +MRK  T  K  SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAEL++++
Sbjct:    5 SSSSMALSSPTLAGKQLKLNPSSQELG-AARFTMRKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE 217          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB21_SOYBN (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 3.297e-98
Identity = 168/183 (91.80%), Postives = 177/183 (96.72%), Query Frame = 3
Query:  141 GRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            GR+SMRKT SK+VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEA WFKAG+QIFSEGGLDYLGN SLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGEVTDP+YPGGSFDPL LADDPEAFAEL++++
Sbjct:   11 GRVSMRKTASKTVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEASWFKAGSQIFSEGGLDYLGNQSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLALADDPEAFAELKVKE 193          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB22_ARATH (Chlorophyll a-b binding protein 2, chloroplastic OS=Arabidopsis thaliana GN=CAB2A PE=1 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 7.346e-98
Identity = 175/215 (81.40%), Postives = 193/215 (89.77%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVS-SGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA STMALSS +F GKAV L+P+ +E+   GR++MRKT +K    SGSPWYG DRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSL+HAQSILAIWA QV+LMGAVEGYR+AG GPLGE  D LYPGGSFDPLGLA DPEAFAEL++++
Sbjct:    1 MAASTMALSSPAFAGKAVKLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE 215          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB21_ORYSJ (Chlorophyll a-b binding protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB1R PE=2 SV=2)

HSP 1 Score: 355.91 bits (912), Expect = 1.253e-97
Identity = 178/216 (82.41%), Postives = 191/216 (88.43%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVNLAPS-GNELSNGGRISMRKTGSK---SVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA +TMALSS  + +A   APS  + L    RI+MRKT +K   + SSGSPWYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLMGAVEGYRIAGGPLGEV DPLYPGG+FDPLGLADDPEAFAEL++++
Sbjct:    1 MAAATMALSSPVMARA---APSTSSALFGEARITMRKTAAKPKPAASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVKE 213          
The following BLAST results are available for this feature:
BLAST of FC876211 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 76
Match NameE-valueIdentityDescription
CB21_SINAL1.581e-10082.71Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB21_MAIZE6.009e-10083.26Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB22_HORVU1.025e-9983.10Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB28_PEA1.480e-9882.49Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB21_WHEAT1.480e-9881.40Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_ARATH1.480e-9881.86Chlorophyll a-b binding protein 165/180, chloropla... [more]
CB22_PEA1.933e-9882.24Chlorophyll a-b binding protein AB80, chloroplasti... [more]
CB21_SOYBN3.297e-9891.80Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB22_ARATH7.346e-9881.40Chlorophyll a-b binding protein 2, chloroplastic O... [more]
CB21_ORYSJ1.253e-9782.41Chlorophyll a-b binding protein 1, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G04EF DevOvary1 Citrus clementina cDNA clone C32001G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876211 ID=FC876211|Name=FC876211|organism=Citrus clementina|type=EST|length=727bp
GACCTCTCAACACTCGAACACTAGAGCTCACCAACAACTCTGATCATTGC
AAAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAGGC
TGTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCATCT
CCATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGCAGCCCGTGGTAC
GGCCCGGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCAAG
CTACTTGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACACAGCCGGGC
TTTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCATC
CACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCT
CTTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCGG
GAGCTCAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAAGC
TTGATCCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTCTT
GATGGGAGCTGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGAAG
TGACCGACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGGCT
GATGACCCGGAGGCTTTTGCTGAGCTCAGGTTAAGGAAATCAAGAATGGA
AGGTTGGCTATGTTCTCCATGTTTGGT
back to top