FC876212

Overview
NameFC876212
Unique NameFC876212
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length670
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10313 contig Ccv1_Contig10313:1..671. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: GALE_HAEIN (UDP-glucose 4-epimerase OS=Haemophilus influenzae GN=galE PE=3 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.661e-11
Identity = 56/170 (32.94%), Postives = 80/170 (47.06%), Query Frame = 2
Query:  158 ILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYC-SNLKNL--IPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGE-----TDEDAVVGNHEASQLLPTNPYSATKAGAEMLV 643
            IL+TG AG+I SH    L+    E  +VVLD L  C S+ K+L  +        KF  GDI    L+  +     I++++HFA    V  S     E+  NN+ GT VL++  K  G +  F+  S+  VYG+       ED  VG         TNPY  +K   E ++
Sbjct:    3 ILVTGGAGYIGSHTVVELLNVGKE--VVVLDNL--CNSSPKSLERVKQITGKEAKFYEGDILDRALLQKIFAENEINSVIHFAGLKAVGESVQKPTEYYMNNVAGTLVLIQEMKKAG-VWNFVFSSSATVYGDPKIIPITEDCEVGG-------TTNPYGTSKYMVEQIL 160          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: GALE_DROME (Probable UDP-glucose 4-epimerase OS=Drosophila melanogaster GN=CG12030 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.661e-11
Identity = 51/172 (29.65%), Postives = 76/172 (44.19%), Query Frame = 2
Query:  149 PKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKL--DYCSNLK-----NLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLV 643
            P  +L+TG AG+I SH    ++     Y ++ +D L   Y S  K     + +         F R DI   + V  +     ID + HFAA   V  S     ++  NN+ GT+VLLEA      + +F++ S+  VYGE     V   H       T+PY  TK   E ++
Sbjct:    3 PPTVLVTGGAGYIGSHTVLEMLN--AGYNVICVDNLCNAYSSGAKLPEALSRVQEITGKKVNFYRVDITDREQVRSVFQEHKIDMVAHFAALKAVGESCRIPLQYYHNNMTGTNVLLEA-MADNNVFKFVYSSSATVYGEPKFLPVTEEHPTGNC--TSPYGKTKYFTEEIL 169          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: GALE1_PEA (UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.661e-11
Identity = 46/162 (28.40%), Postives = 76/162 (46.91%), Query Frame = 2
Query:  152 KNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYC-----SNLKNLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATK 622
            + IL+TG+AGFI +H   +L+ N   + + ++D  D         ++ ++ S  S N +F  GD+ + D +  L      D ++HFA    V  S  N   +  NN+ GT  L E        ++ +  S+  VYG+ ++   V   E  +L   NPY  TK
Sbjct:    6 QKILVTGSAGFIGTHTVVQLLNN--GFNVSIIDNFDNSVMEAVERVREVVGSNLSQNLEFTLGDLRNKDDLEKLFSKSKFDAVIHFAGLKAVGESVENPRRYFDNNLVGTINLYEV-MAKHNCKKMVFSSSATVYGQPEKIPCV---EDFKLQAMNPYGRTK 161          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: GAE4_ARATH (UDP-glucuronate 4-epimerase 4 OS=Arabidopsis thaliana GN=GAE4 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.539e-11
Identity = 54/174 (31.03%), Postives = 76/174 (43.68%), Query Frame = 2
Query:  158 ILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLD--YCSNLKNLIPSKAS-SNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 670
            +L+TGAAGF+ +HV   L R      ++ LD  +  Y  +LK    +    S    V GDI   +L+  L    S   +MH AAQ  V  +  N   +  +NI G   LLE CK        +  S+  VYG   +       +  Q  P + Y+ATK   E +   Y   YGL
Sbjct:   99 VLVTGAAGFVGTHVSAALKRRGDG--VIGLDNFNDYYDPSLKRARRALLERSGIFIVEGDINDVELLRKLFKIVSFTHVMHLAAQAGVRYAMENPSSYVHSNIAGFVNLLEICKSVNPQPAIVWASSSSVYGLNTKVPFSEKDKTDQ--PASLYAATKKAGEEIAHTYNHIYGL 268          
The following BLAST results are available for this feature:
BLAST of FC876212 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
GALE_HAEIN2.661e-1132.94UDP-glucose 4-epimerase OS=Haemophilus influenzae ... [more]
GALE_DROME2.661e-1129.65Probable UDP-glucose 4-epimerase OS=Drosophila mel... [more]
GALE1_PEA2.661e-1128.40UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE P... [more]
GAE4_ARATH4.539e-1131.03UDP-glucuronate 4-epimerase 4 OS=Arabidopsis thali... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G06EF DevOvary1 Citrus clementina cDNA clone C32001G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876212 ID=FC876212|Name=FC876212|organism=Citrus clementina|type=EST|length=670bp
GCTCACTCTTCAAAAGATCACCGCGGTTTCTTCTCAGTTTCCATTTTCAC
ACAGTTTCTCTCTCTAGATTCGCGTTTTGGCATTTGGGTTTGACTCGTCT
TCGTTGATCTGATCGTCTTTAAGTTGATTTGCAATGGCTACGTATACCCC
GAAGAACATCCTCATCACTGGGGCTGCTGGGTTCATTGCTTCCCATGTAT
GCAACCGGCTGATTCGTAACTATCCCGAGTACAAAATTGTTGTGCTTGAC
AAGCTTGATTATTGTTCGAATCTGAAAAACCTAATACCCTCCAAAGCATC
CTCCAACTTTAAGTTTGTTAGGGGGGACATTGCCAGTGCTGACCTTGTCA
ACTTTCTTCTCATCACTGAGTCCATTGACACTATTATGCACTTTGCTGCG
CAAACTCATGTGGACAACTCTTTTGGAAATAGTTTTGAGTTTACCAAGAA
CAATATCTATGGTACTCATGTCCTCCTTGAAGCCTGCAAAGTGACTGGGC
AGATCCGGAGGTTCATCCATGTCAGCACAGATGAGGTCTATGGGGAGACT
GACGAGGATGCTGTTGTGGGTAACCATGAAGCTTCCCAACTCCTGCCAAC
AAATCCTTATTCTGCAACTAAAGCTGGAGCAGAAATGCTTGTTATGGCTT
ATGGTAGGTCATATGGGCTA
back to top