FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_HUMAN (60 kDa heat shock protein, mitochondrial OS=Homo sapiens GN=HSPD1 PE=1 SV=2)

HSP 1 Score: 259.225 bits (661), Expect = 1.596e-68
Identity = 127/215 (59.07%), Postives = 170/215 (79.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  ARA MLQGV  +A+AV VTMGPKGR VIIE+S G+PKVTKDGVTVA SI+ +DK K++GA LV+ VA  TN+ AGDGTT ATVL ++I  EG + ++ G N +++R G+ +A+DAVI++LK +++ ++TPEEI QVATISANG++EIG +++ AM+KVG++GVITV DG T+ +ELE + GMK  RGYISPYF+   K QKCE ++
Sbjct:   27 AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQD 241          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: HSP60_CANAL (Heat shock protein 60, mitochondrial OS=Candida albicans GN=HSP60 PE=3 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 2.723e-68
Identity = 132/221 (59.73%), Postives = 170/221 (76.92%), Query Frame = 3
Query:   63 RNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            R+   K++ FGV  RAA+L+GV+ +A+AV VT+GPKGRNV+IE+  G PK+TKDGVTVA +I   DK +D+GA L+++VA  TN++AGDGTT ATVL ++I TE  K+VAAG N MDLR G + A++AVI  L+   + I+T EEI QVATISANG++ IG+LLA AMEKVGKEGVITV +G T+ +ELE   GMK  RG+ISPYF+T+ KT K E ENPL
Sbjct:   15 RHLSHKELKFGVEGRAALLKGVNTLADAVSVTLGPKGRNVLIEQQFGAPKITKDGVTVAKAITLEDKFEDLGAKLLQEVASKTNESAGDGTTSATVLGRSIFTESVKNVAAGCNPMDLRRGSQAAVEAVIEFLQKNKKEITTSEEIAQVATISANGDKHIGDLLANAMEKVGKEGVITVKEGKTLEDELEVTEGMKFDRGFISPYFITNTKTGKVEFENPL 235          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_RAT (60 kDa heat shock protein, mitochondrial OS=Rattus norvegicus GN=Hspd1 PE=1 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.556e-68
Identity = 126/215 (58.60%), Postives = 170/215 (79.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  ARA MLQGV  +A+AV VTMGPKGR VIIE+S G+PKVTKDGVTVA SI+ +DK K++GA LV+ VA  TN+ AGDGTT ATVL ++I  EG + ++ G N +++R G+ +A+DAVI++LK +++ ++TPEEI QVATISANG+++IG +++ AM+KVG++GVITV DG T+ +ELE + GMK  RGYISPYF+   K QKCE ++
Sbjct:   27 AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQD 241          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_MOUSE (60 kDa heat shock protein, mitochondrial OS=Mus musculus GN=Hspd1 PE=1 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.556e-68
Identity = 126/215 (58.60%), Postives = 170/215 (79.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  ARA MLQGV  +A+AV VTMGPKGR VIIE+S G+PKVTKDGVTVA SI+ +DK K++GA LV+ VA  TN+ AGDGTT ATVL ++I  EG + ++ G N +++R G+ +A+DAVI++LK +++ ++TPEEI QVATISANG+++IG +++ AM+KVG++GVITV DG T+ +ELE + GMK  RGYISPYF+   K QKCE ++
Sbjct:   27 AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQD 241          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_PONAB (60 kDa heat shock protein, mitochondrial OS=Pongo abelii GN=HSPD1 PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 4.644e-68
Identity = 126/215 (58.60%), Postives = 170/215 (79.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  ARA ML+GV  +A+AV VTMGPKGR VIIE+S G+PKVTKDGVTVA SI+ +DK K++GA LV+ VA  TN+ AGDGTT ATVL ++I  EG + ++ G N +++R G+ +A+DAVI++LK +++ ++TPEEI QVATISANG++EIG +++ AM+KVG++GVITV DG T+ +ELE + GMK  RGYISPYF+   K QKCE ++
Sbjct:   27 AKDVKFGADARALMLRGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQD 241          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_CRIGR (60 kDa heat shock protein, mitochondrial OS=Cricetulus griseus GN=HSPD1 PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 7.922e-68
Identity = 125/215 (58.14%), Postives = 170/215 (79.07%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  ARA MLQGV  +A+AV VTMGPKGR VIIE+S G+PKVTKDGVTVA +I+ +DK K++GA LV+ VA  TN+ AGDGTT ATVL ++I  EG + ++ G N +++R G+ +A+DAVI++LK +++ ++TPEEI QVATISANG+++IG +++ AM+KVG++GVITV DG T+ +ELE + GMK  RGYISPYF+   K QKCE ++
Sbjct:   27 AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQD 241          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BOVIN (60 kDa heat shock protein, mitochondrial OS=Bos taurus GN=HSPD1 PE=1 SV=2)

HSP 1 Score: 256.914 bits (655), Expect = 7.922e-68
Identity = 126/215 (58.60%), Postives = 169/215 (78.60%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  ARA MLQGV  +A+AV VTMGPKGR VIIE+S G+P+VTKDGVTVA SI+ +DK K++GA LV+ VA  TN+ AGDGTT ATVL ++I  EG + ++ G N +++R G+ +A+DAVI +LK +++ ++TPEEI QVATISANG++EIG +++ AM+KVG++GVITV DG T+ +ELE + GMK  RGYISPYF+   K QKCE ++
Sbjct:   27 AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPRVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIVELKKQSKPVTTPEEIAQVATISANGDKEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQD 241          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: HSP60_PARBA (Heat shock protein 60, mitochondrial OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=HSP60 PE=1 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.765e-67
Identity = 130/241 (53.94%), Postives = 176/241 (73.03%), Query Frame = 3
Query:    3 ASSISSPRCKKGVYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            ASS  +P  +    G  L  + +  K++ FGV ARA++L+G+  +A+AV  T+GPKGRNV+IE   G+PK+TKDGVTVA ++  +DK +++GA L++ VA  TN+ AGDGTT ATVL +AI +E  K+VAAG N MDLR GI+ A++AV+  L++  + I+T EEI QVATISANG+  +G+L++ AMEKVGKEGVITV DG T+ +ELE   GM+  RGY+SPYF+TD K QK E E PL
Sbjct:   16 ASSTRAPLSRFRSAGVGLQQQRFAHKELKFGVEARASLLKGIDTLAKAVTTTLGPKGRNVLIESPYGSPKITKDGVTVAKAVTLQDKFENLGARLLQDVASKTNEVAGDGTTTATVLARAIFSETVKNVAAGCNPMDLRRGIQSAVEAVVEYLQTNKRDITTTEEIAQVATISANGDTHVGKLISNAMEKVGKEGVITVKDGKTIDDELEVTEGMRFDRGYVSPYFITDTKAQKVEFEKPL 256          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_CHICK (60 kDa heat shock protein, mitochondrial OS=Gallus gallus GN=HSPD1 PE=1 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.305e-67
Identity = 125/215 (58.14%), Postives = 168/215 (78.14%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELEN 719
            AKD+ FG  ARA MLQGV  +A+AV VTMGPKGR VIIE+S G+PKVTKDGVTVA +I+ +DK K++GA LV+ VA  TN+ AGDGTT ATVL +AI  EG + ++ G N +++R G+ +A+DA+ ++LK  ++ ++TPEEI QVATISANG++EIG +++ AM+KVG++GVITV DG T+ +ELE + GMK  RGYISPYF+   K QKCE ++
Sbjct:   27 AKDVKFGADARALMLQGVDLLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKAIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLARAIAKEGFEKISKGANPVEIRRGVMLAVDAITAELKKLSKPVTTPEEIAQVATISANGDQEIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTAKGQKCEFQD 241          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: HSP60_YEAST (Heat shock protein 60, mitochondrial OS=Saccharomyces cerevisiae GN=HSP60 PE=1 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 3.010e-67
Identity = 132/227 (58.15%), Postives = 171/227 (75.33%), Query Frame = 3
Query:   48 RVLCNRNYVA-KDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            R L  R Y + K++ FGV  RA++L+GV  +AEAV  T+GPKGRNV+IE+  G PK+TKDGVTVA SI  +DK +++GA L+++VA  TN+AAGDGTT ATVL +AI TE  K+VAAG N MDLR G ++A++ VI  L +  + I+T EEI QVATISANG+  +G+LLA AMEKVGKEGVIT+ +G T+ +ELE   GM+  RG+ISPYF+TDPK+ K E E PL
Sbjct:   14 RPLLRRAYSSHKELKFGVEGRASLLKGVETLAEAVAATLGPKGRNVLIEQPFGPPKITKDGVTVAKSIVLKDKFENMGAKLLQEVASKTNEAAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGSQVAVEKVIEFLSANKKEITTSEEIAQVATISANGDSHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGMRFDRGFISPYFITDPKSSKVEFEKPL 240          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_HUMAN1.596e-6859.0760 kDa heat shock protein, mitochondrial OS=Homo s... [more]
HSP60_CANAL2.723e-6859.73Heat shock protein 60, mitochondrial OS=Candida al... [more]
CH60_RAT3.556e-6858.6060 kDa heat shock protein, mitochondrial OS=Rattus... [more]
CH60_MOUSE3.556e-6858.6060 kDa heat shock protein, mitochondrial OS=Mus mu... [more]
CH60_PONAB4.644e-6858.6060 kDa heat shock protein, mitochondrial OS=Pongo ... [more]
CH60_CRIGR7.922e-6858.1460 kDa heat shock protein, mitochondrial OS=Cricet... [more]
CH60_BOVIN7.922e-6858.6060 kDa heat shock protein, mitochondrial OS=Bos ta... [more]
HSP60_PARBA1.765e-6753.94Heat shock protein 60, mitochondrial OS=Paracoccid... [more]
CH60_CHICK2.305e-6758.1460 kDa heat shock protein, mitochondrial OS=Gallus... [more]
HSP60_YEAST3.010e-6758.15Heat shock protein 60, mitochondrial OS=Saccharomy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top