FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_SHEHH (60 kDa chaperonin OS=Shewanella halifaxensis (strain HAW-EB4) GN=groL PE=3 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 5.314e-64
Identity = 123/216 (56.94%), Postives = 161/216 (74.54%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AK++ FG  AR  ML GV+ +A AVKVT+GPKGRNV+++KS G P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL QAI+TEG K+VAAG+N MDL+ GI  A+ A +++LK+ +Q  S  + I QV TISAN +  IGE++A AME+VGKEGVITV +G  + NEL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKEVLFGNDARVKMLAGVNVLANAVKVTLGPKGRNVVLDKSFGAPLITKDGVSVAKEIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVTEGLKAVAAGMNPMDLKRGIDKAVIAAVAELKNLSQECSDTKAIAQVGTISANSDESIGEIIATAMERVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_YERPY (60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +GEL+A+AMEKVGKEGVITV +G+ + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIAQAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_YERPS (60 kDa chaperonin OS=Yersinia pseudotuberculosis GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +GEL+A+AMEKVGKEGVITV +G+ + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIAQAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_YERPP (60 kDa chaperonin OS=Yersinia pestis (strain Pestoides F) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +GEL+A+AMEKVGKEGVITV +G+ + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIAQAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_YERPN (60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +GEL+A+AMEKVGKEGVITV +G+ + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIAQAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_YERPG (60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Angola) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +GEL+A+AMEKVGKEGVITV +G+ + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIAQAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_YERPE (60 kDa chaperonin OS=Yersinia pestis GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +GEL+A+AMEKVGKEGVITV +G+ + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIAQAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_YERPB (60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +GEL+A+AMEKVGKEGVITV +G+ + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIAQAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_YERPA (60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +GEL+A+AMEKVGKEGVITV +G+ + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIAQAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_YERP3 (60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=groL PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.940e-64
Identity = 122/216 (56.48%), Postives = 163/216 (75.46%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENP 722
            AKD+ FG  AR  ML+GV+ +A+AVKVT+GPKGRNV+++KS G+P +TKDGV+VA  IE  DK +++GA +VK+VA   N AAGDGTT ATVL Q+I+TEG K+VAAG+N MDL+ GI  A+ A + +LK  +   S  + I QV TISAN +  +GEL+A+AMEKVGKEGVITV +G+ + +EL+ V GM+  RGY+SPYF+  P+T   ELE+P
Sbjct:    3 AKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFGSPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGLKAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIAQAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESP 218          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_SHEHH5.314e-6456.9460 kDa chaperonin OS=Shewanella halifaxensis (stra... [more]
CH60_YERPY6.940e-6456.4860 kDa chaperonin OS=Yersinia pseudotuberculosis s... [more]
CH60_YERPS6.940e-6456.4860 kDa chaperonin OS=Yersinia pseudotuberculosis G... [more]
CH60_YERPP6.940e-6456.4860 kDa chaperonin OS=Yersinia pestis (strain Pesto... [more]
CH60_YERPN6.940e-6456.4860 kDa chaperonin OS=Yersinia pestis bv. Antiqua (... [more]
CH60_YERPG6.940e-6456.4860 kDa chaperonin OS=Yersinia pestis bv. Antiqua (... [more]
CH60_YERPE6.940e-6456.4860 kDa chaperonin OS=Yersinia pestis GN=groL PE=3 ... [more]
CH60_YERPB6.940e-6456.4860 kDa chaperonin OS=Yersinia pseudotuberculosis s... [more]
CH60_YERPA6.940e-6456.4860 kDa chaperonin OS=Yersinia pestis bv. Antiqua (... [more]
CH60_YERP36.940e-6456.4860 kDa chaperonin OS=Yersinia pseudotuberculosis s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top