FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_AQUAE (Adenosylhomocysteinase OS=Aquifex aeolicus GN=ahcY PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.010e-14
Identity = 50/138 (36.23%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  116 EFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            EF VKDLS A+ G   IE AE++MP L   R  F   +P KG KI+  LH+T +TA L+ TL   GAEV   + N  STQD                 +GE  + Y+      ++      PD+++DDG D    +H+
Sbjct:    2 EFDVKDLSLAEEGLKRIEWAEMDMPVLRQIRERFSKEKPLKGKKISACLHVTTETANLMRTLKEGGAEVYLTASNPLSTQDDVAAALVKYFEIPVFAIRGEDRETYYKHLRAVIE----KEPDVVIDDGADLISTLHK 135          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_THEAC (Adenosylhomocysteinase OS=Thermoplasma acidophilum GN=ahcY PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.101e-11
Identity = 43/125 (34.40%), Postives = 60/125 (48.00%), Query Frame = 2
Query:  152 GRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            G L +  A   MP +   R  F   +PFKG K+  +LH+  +T +    L   GAEV+  SCN  S+ D                 KGET +EY+    + LD      PD+I+DDGGD T ++H
Sbjct:    6 GFLRLAWARDHMPVIAEIRKRFQAEKPFKGIKVAMALHVEAKTGIFALLLKEGGAEVKMASCNPLSSDDSVVQSLKEDYGMPVFARKGETSEEYYEYLHRTLD----VQPDIIIDDGGDLTKIVH 126          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METAC (Adenosylhomocysteinase OS=Methanosarcina acetivorans GN=ahcY PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.438e-11
Identity = 47/141 (33.33%), Postives = 67/141 (47.52%), Query Frame = 2
Query:  152 GRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWK-GETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLP 571
            G +++E A   MP +   R +F   +P KG K+  +LH+  +TAVL+ETL A GA+V    CN  STQD                + G    EY+   +K LD      PD+ +DDG D    +H+        E+T  LP
Sbjct:   10 GNMKMEWARNHMPVIAIIREKFEKEKPLKGLKVGMALHVEAKTAVLVETLAAGGAQVAISGCNPLSTQDDVARALDTRKNISCFARYGCCTSEYYEAIDKVLDI----EPDITIDDGADLIFKLHK--------ERTDLLP 138          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METMA (Adenosylhomocysteinase OS=Methanosarcina mazei GN=ahcY PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.879e-11
Identity = 44/126 (34.92%), Postives = 62/126 (49.21%), Query Frame = 2
Query:  152 GRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWK-GETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHE 526
            G +++E A   MP L   R +F   +P KG K+  +LH+  +TAVL+ETL A GA+V    CN  STQD                K G    EY+   ++ LD      PD+ +DDG D    +H+
Sbjct:   10 GNMKMEWARNHMPVLAIIREKFEKEKPLKGLKVGMALHVEAKTAVLVETLAAGGAQVAISGCNPLSTQDDVAAALDTRENINCFAKYGCCTGEYYEAIDRVLDI----EPDITIDDGADLIFKLHK 131          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_THEVO (Adenosylhomocysteinase OS=Thermoplasma volcanium GN=ahcY PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.454e-11
Identity = 44/125 (35.20%), Postives = 60/125 (48.00%), Query Frame = 2
Query:  152 GRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIH 523
            G L +E A   MP +   R  F   +PFKG  I  +LH+  +T +    L   GA VR  SCN  S+ D                 KGET +EY+   ++ L+      PD+I+DDGGD T L+H
Sbjct:    6 GFLRLEWARDHMPVIAEIRKRFLDEKPFKGINIAMALHVEAKTGIFSLLLKEGGANVRMASCNPLSSDDSVVESLKTDYGMPVFARKGETQEEYYENLQRTLE----KPPDIIIDDGGDLTKLVH 126          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_AQUAE9.010e-1436.23Adenosylhomocysteinase OS=Aquifex aeolicus GN=ahcY... [more]
SAHH_THEAC1.101e-1134.40Adenosylhomocysteinase OS=Thermoplasma acidophilum... [more]
SAHH_METAC1.438e-1133.33Adenosylhomocysteinase OS=Methanosarcina acetivora... [more]
SAHH_METMA1.879e-1134.92Adenosylhomocysteinase OS=Methanosarcina mazei GN=... [more]
SAHH_THEVO2.454e-1135.20Adenosylhomocysteinase OS=Thermoplasma volcanium G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top