FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METEP (Adenosylhomocysteinase OS=Methylobacterium extorquens (strain PA1) GN=ahcY PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.989e-45
Identity = 94/170 (55.29%), Postives = 113/170 (66.47%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVL 613
            A   ++ VKD+  AD+GR EI +AE EMPGLM+ RAE+G SQP KGAKI GSLHMTIQTAVLIETL ALGA++RW SCNI+STQDH               KGETL EYW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    2 AVANDYIVKDIGLADYGRKEISIAETEMPGLMSTRAEYGASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTSKLFDWHDGGMPNMILDDGGDATMFVHLGLRAEN--GDTAFLDKPESEEEEVFFALL 169          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METC4 (Adenosylhomocysteinase OS=Methylobacterium chloromethanicum (strain CM4 / NCIMB 13688) GN=ahcY PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.989e-45
Identity = 94/170 (55.29%), Postives = 113/170 (66.47%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVL 613
            A   ++ VKD+  AD+GR EI +AE EMPGLM+ RAE+G SQP KGAKI GSLHMTIQTAVLIETL ALGA++RW SCNI+STQDH               KGETL EYW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    2 AVANDYIVKDIGLADYGRKEISIAETEMPGLMSTRAEYGASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTSKLFDWHDGGMPNMILDDGGDATMFVHLGLRAEN--GDTAFLDKPESEEEEVFFALL 169          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RHOPS (Adenosylhomocysteinase OS=Rhodopseudomonas palustris (strain BisB5) GN=ahcY PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.392e-45
Identity = 93/171 (54.39%), Postives = 115/171 (67.25%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVL 613
            +A   ++ VKD+  A+FGR EI LAE EMPGLMA R E+GP QP KGA+I GSLHMTIQTAVLIETLTALGA+VRW SCNI+STQDH               KGE+L++YW  T +  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    2 TAKFTDYIVKDIGLAEFGRKEISLAETEMPGLMATREEYGPKQPLKGARIAGSLHMTIQTAVLIETLTALGADVRWVSCNIYSTQDHAAAAIAAAGIPVFAIKGESLEDYWDYTARMFDWHGGGTPNMILDDGGDATMYVHLGLRAEN--GDTAFLDKPGSDEEVIFFALL 170          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METS4 (Adenosylhomocysteinase OS=Methylobacterium sp. (strain 4-46) GN=ahcY PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.392e-45
Identity = 96/177 (54.24%), Postives = 117/177 (66.10%), Query Frame = 2
Query:  107 SGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            S +++ V+D+  ADFGR EI +AE EMPGLMA RAE+  SQP KGAKI GSLHMTIQTAVLIETL ALGA++RW SCNI+STQDH               KGETL EYW  T +  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S    E +I   +I+  LK
Sbjct:    3 SNQDYIVRDIGLADFGRKEIAIAETEMPGLMAVRAEYAASQPLKGAKIAGSLHMTIQTAVLIETLKALGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTARLFDWHDGGMPNMILDDGGDATMFVHAGLRAER--GDTAFLDAPGS---EEEEIFFALIKRMLK 174          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_SINMW (Adenosylhomocysteinase OS=Sinorhizobium medicae (strain WSM419) GN=ahcY PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.430e-45
Identity = 89/146 (60.96%), Postives = 105/146 (71.92%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            ++ +++ V D+  ADFGR EI +AE EMPGLMACR EFG S+P KGA+ITGSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH               KGETL+EYW  T+K   W  GG  ++I+DDGGDAT+ I  G +AE
Sbjct:    2 SANQDYIVADIGLADFGRKEIAIAETEMPGLMACREEFGASKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAVKGETLEEYWTYTDKIFQWADGGVSNMILDDGGDATMYILLGARAE 147          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PROVI (Adenosylhomocysteinase OS=Prosthecochloris vibrioformis (strain DSM 265) (strain DSM 265) GN=ahcY PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.430e-45
Identity = 88/157 (56.05%), Postives = 114/157 (72.61%), Query Frame = 2
Query:  101 SASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE---EIYEKTG 562
            +A+  ++KV D+S A++GR EI++AE EMPGLMA R ++   +P  G++I+GSLHMTIQTAVLIETL  LGA+VRW SCNIFSTQDH              WKGE+L+EYWWCT + LD+G G GP+LIVDDGGDAT++I  G K E    +++K G
Sbjct:    4 AATALDYKVADISLAEWGRKEIDIAEKEMPGLMAIRNKYKGQKPLAGSRISGSLHMTIQTAVLIETLVELGADVRWASCNIFSTQDHAAAAIAVTGVPVFAWKGESLEEYWWCTRQILDFGNGLGPNLIVDDGGDATMMIILGYKVENNPSMFDKGG 160          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_METPB (Adenosylhomocysteinase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=ahcY PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.430e-45
Identity = 93/170 (54.71%), Postives = 113/170 (66.47%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVL 613
            A+  ++ V+D+  AD+GR EI +AE EMPGLMA RAE+G SQP KGAKI GSLHMTIQTAVLIETL  LGA++RW SCNI+STQDH               KGETL EYW  T K  DW  GG P++I+DDGGDAT+ +H G++AE     T  L  P S +   F  +L
Sbjct:    2 AAANDYIVRDIGLADYGRKEISIAETEMPGLMATRAEYGASQPLKGAKIAGSLHMTIQTAVLIETLKHLGADIRWVSCNIYSTQDHAAAAIAAAGIPVFAVKGETLTEYWDYTSKLFDWHDGGMPNMILDDGGDATMFVHLGLRAEN--GDTAFLDKPESEEEEVFFALL 169          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_DESVM (Adenosylhomocysteinase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=ahcY PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 4.430e-45
Identity = 90/165 (54.55%), Postives = 114/165 (69.09%), Query Frame = 2
Query:  122 KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH-XXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVL 613
            KV D++ ADFG  E++L+E E+PGLM     +G S+P KG ++TGSLHMTIQTA+LI+TL  LGA++RW SCNIFSTQDH               WKGETL++YWWCTE AL W  G GPDL+VDDGGDATL+IH+GV+ E   E   +     + D  EFQI++
Sbjct:   17 KVADMALADFGHKEMQLSEREVPGLMELIRMYGVSKPLKGLRVTGSLHMTIQTAMLIKTLYELGADIRWASCNIFSTQDHAAAAIADSGMAKVFAWKGETLEDYWWCTEMALTWPDGSGPDLLVDDGGDATLMIHKGVEVENNPELLKQ-----AYDNKEFQIIM 176          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_CHLCH (Adenosylhomocysteinase OS=Chlorobium chlorochromatii (strain CaD3) GN=ahcY PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 5.786e-45
Identity = 92/159 (57.86%), Postives = 107/159 (67.30%), Query Frame = 2
Query:  104 ASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPA 580
            A    +KV D+S A++GR EIE+AE EMPGLMA R ++   +P KGA+I GSLHMTIQTAVLIETL  LGA VRW SCNIFSTQDH              WKGETL EYWWCT + L++  G GP+LIVDDGGDATL+I  G K E   +   K P  A
Sbjct:    5 AEALAYKVADISLAEWGRKEIEIAEKEMPGLMALRKKYAGQKPLKGARIAGSLHMTIQTAVLIETLVDLGANVRWASCNIFSTQDHAAAAIAQAGVPVFAWKGETLDEYWWCTRQILEFDGGLGPNLIVDDGGDATLMIILGHKIENDPKMLDKTPGNA 163          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_RHIME (Adenosylhomocysteinase OS=Rhizobium meliloti GN=ahcY PE=3 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 7.557e-45
Identity = 89/143 (62.24%), Postives = 103/143 (72.03%), Query Frame = 2
Query:  113 REFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAE 541
            +++ V D+  ADFGR EI +AE EMPGLMACR EFG S+P KGA+ITGSLHMTIQTAVLIETL ALGAEVRW SCNIFSTQDH               KGETL+EYW  T+K   W  GG  ++I+DDGGDAT+ I  G +AE
Sbjct:    5 QDYIVADIGLADFGRKEIAIAETEMPGLMACREEFGASKPLKGARITGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAASGVPVFAVKGETLEEYWTYTDKIFQWADGGVSNMILDDGGDATMYILLGARAE 147          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_METEP1.989e-4555.29Adenosylhomocysteinase OS=Methylobacterium extorqu... [more]
SAHH_METC41.989e-4555.29Adenosylhomocysteinase OS=Methylobacterium chlorom... [more]
SAHH_RHOPS3.392e-4554.39Adenosylhomocysteinase OS=Rhodopseudomonas palustr... [more]
SAHH_METS43.392e-4554.24Adenosylhomocysteinase OS=Methylobacterium sp. (st... [more]
SAHH_SINMW4.430e-4560.96Adenosylhomocysteinase OS=Sinorhizobium medicae (s... [more]
SAHH_PROVI4.430e-4556.05Adenosylhomocysteinase OS=Prosthecochloris vibriof... [more]
SAHH_METPB4.430e-4554.71Adenosylhomocysteinase OS=Methylobacterium populi ... [more]
SAHH_DESVM4.430e-4554.55Adenosylhomocysteinase OS=Desulfovibrio vulgaris (... [more]
SAHH_CHLCH5.786e-4557.86Adenosylhomocysteinase OS=Chlorobium chlorochromat... [more]
SAHH_RHIME7.557e-4562.24Adenosylhomocysteinase OS=Rhizobium meliloti GN=ah... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top