FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: THS2_ARAHY (Putative stilbene synthase 2 (Fragment) OS=Arachis hypogaea PE=5 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.890e-52
Identity = 86/105 (81.90%), Postives = 96/105 (91.43%), Query Frame = 2
Query:  281 LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            LKENPNMCAY APSLDAR+D+++ EVP++GKEAATKAIKEWGQP SKITHLIFCTTSGV +PG DY+L  L+GL PSVKR+MMY QGCFAGGTVLRLAKDLAENN
Sbjct:    1 LKENPNMCAYKAPSLDAREDMMIREVPRVGKEAATKAIKEWGQPMSKITHLIFCTTSGVALPGVDYELIVLLGLDPSVKRYMMYHQGCFAGGTVLRLAKDLAENN 105          

HSP 2 Score: 43.1282 bits (100), Expect = 2.890e-52
Identity = 19/25 (76.00%), Postives = 23/25 (92.00%), Query Frame = 1
Query:  601 ARVLVVCSEITAVTFRGPADTHLDS 675
            ARVL+VCSE TAVTFRGP++T +DS
Sbjct:  108 ARVLIVCSENTAVTFRGPSETDMDS 132          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS6_MEDSA (Chalcone synthase 6-4 (Fragment) OS=Medicago sativa GN=CHS6-4 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.261e-46
Identity = 73/77 (94.81%), Postives = 75/77 (97.40%), Query Frame = 2
Query:  365 LGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 LGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 77          

HSP 2 Score: 54.299 bits (129), Expect = 1.261e-46
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:   78 KGARVLVVCSEVTAVTFRGPSDTHLDS 104          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS7_MEDSA (Chalcone synthase (Fragment) OS=Medicago sativa GN=CHSII PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.954e-33
Identity = 53/58 (91.38%), Postives = 55/58 (94.83%), Query Frame = 2
Query:  422 ITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            ITHLI CTTS VDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 ITHLIVCTTS-VDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENN 57          

HSP 2 Score: 54.299 bits (129), Expect = 5.954e-33
Identity = 24/27 (88.89%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSE+TAVTFRGP+DTHLDS
Sbjct:   58 KGARVLVVCSEVTAVTFRGPSDTHLDS 84          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_MALDO (Chalcone synthase (Fragment) OS=Malus domestica GN=CHS PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 8.090e-17
Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+DTHLDS
Sbjct:   25 KGARVLVVCSEITAVTFRGPSDTHLDS 51          

HSP 2 Score: 53.1434 bits (126), Expect = 8.090e-17
Identity = 24/24 (100.00%), Postives = 24/24 (100.00%), Query Frame = 2
Query:  524 MMYQQGCFAGGTVLRLAKDLAENN 595
            MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MMYQQGCFAGGTVLRLAKDLAENN 24          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: PKS1_DICDI (Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 6.210e-16
Identity = 54/196 (27.55%), Postives = 99/196 (50.51%), Query Frame = 2
Query:    2 TLTKHEPQTYSLRVQLEMATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAE 589
            ++ +H+ Q   ++V ++       R + +++  + VL IG + P   ++Q    D        +   E  EK KR+ ++S IK R++ + +    EN     ++    D       V VP L ++A  +A+K+WG  K  ITH++  T++G+ +P  +++L  L+GL   V+R  +   GC AG + LR A  LA+
Sbjct: 2755 SVQQHQKQQQKVQV-IQQQQQPLSRLSYKSNNNSFVLGIGISVPGEPISQQSLKDSISNDFSDK--AETNEKVKRIFEQSQIKTRHL-VRDYTKPENSIKFRHLETITDVNNQFKKV-VPDLAQQACLRALKDWGGDKGDITHIVSVTSTGIIIPDVNFKLIDLLGLNKDVERVSLNLMGCLAGLSSLRTAASLAK 2945          

HSP 2 Score: 21.1718 bits (43), Expect = 6.210e-16
Identity = 7/14 (50.00%), Postives = 12/14 (85.71%), Query Frame = 1
Query:  604 RVLVVCSEITAVTF 645
            R+LVVC+E+ ++ F
Sbjct: 2951 RILVVCTEVCSLHF 2964          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
THS2_ARAHY2.890e-5281.90Putative stilbene synthase 2 (Fragment) OS=Arachis... [more]
CHS6_MEDSA1.261e-4694.81Chalcone synthase 6-4 (Fragment) OS=Medicago sativ... [more]
CHS7_MEDSA5.954e-3391.38Chalcone synthase (Fragment) OS=Medicago sativa GN... [more]
CHSY_MALDO8.090e-1792.59Chalcone synthase (Fragment) OS=Malus domestica GN... [more]
PKS1_DICDI6.210e-1627.55Probable polyketide synthase 1 OS=Dictyostelium di... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top