FC876220

Overview
NameFC876220
Unique NameFC876220
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:8..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS7_PICMA (Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 2.290e-105
Identity = 155/182 (85.16%), Postives = 172/182 (94.51%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            MA ++  R AQRADGPAT+LAIGTATP ++V+Q+ YPDYYF+IT SEHMTELKEKF+RMCDKS IKKRY+YLT+EILKENPN+C YMAPSLDARQD+VVVEVP+LGKEAATKAIKEWGQPKSKITH+IFCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    6 MADLEAFRKAQRADGPATILAIGTATPPNAVDQSTYPDYYFKITNSEHMTELKEKFQRMCDKSAIKKRYMYLTDEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHVIFCTTSGVDMPGADYQLTKLLGLRPSVKRVMMYQQGCFAGGTVLRVAKDLAENNR 187          

HSP 2 Score: 78.5666 bits (192), Expect = 2.290e-105
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDS+VGQALFGDGAAA+
Sbjct:  187 RGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAL 227          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS1_CITSI (Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 3.899e-105
Identity = 155/182 (85.16%), Postives = 171/182 (93.96%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV E+R AQRA GPAT++AIGTATP + V+Q+ YPDYYFRIT SEHMT+LKEKFKRMCDKSMIKKRY+YLTEEILKENPN+CAYMAPSLD RQD+VVVEVP+LGK AAT+AIKEWGQPKSKITHL+FCTTSGVDMPGADY+LTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVDEVRKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCDKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGK-AATEAIKEWGQPKSKITHLVFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 181          

HSP 2 Score: 80.1073 bits (196), Expect = 3.899e-105
Identity = 38/41 (92.68%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  181 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAI 221          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_CHRAE (Chalcone synthase OS=Chrysosplenium americanum GN=CHS PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 5.086e-105
Identity = 155/181 (85.64%), Postives = 170/181 (93.92%), Query Frame = 3
Query:   54 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            A ++EIRNAQRA+GPAT+LAIGTATPA+ V QADYPD+YFRIT SEH TELKEKF+RMCDKSMIKKRY++LTE++LKENP MC YMAPSLDARQD+VVVE+ KLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCF GGTVLRLAKDLAENNR
Sbjct:    5 ALMEEIRNAQRAEGPATILAIGTATPANCVIQADYPDFYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEDLLKENPKMCEYMAPSLDARQDMVVVEIRKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFPGGTVLRLAKDLAENNR 185          

HSP 2 Score: 79.337 bits (194), Expect = 5.086e-105
Identity = 38/41 (92.68%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALFGDGAAA+
Sbjct:  185 RGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAL 225          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSA_PETHY (Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 5.087e-105
Identity = 156/182 (85.71%), Postives = 170/182 (93.41%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E R AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH T+LKEKFKRMC+KSMIKKRY++LTEEILKENP+MC YMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPG DYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEEYRKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKKRYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 77.411 bits (189), Expect = 5.087e-105
Identity = 37/41 (90.24%), Postives = 39/41 (95.12%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP DTHLDSLVGQALFGDGA A+
Sbjct:  182 KGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAI 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS3_CAMSI (Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 5.087e-105
Identity = 157/182 (86.26%), Postives = 169/182 (92.86%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+++  AQRA GPATVLAIGTATP + V+Q+ YPDYYFRIT SEH  ELKEKFKRMCDKSMIKKRY+YLTEEILKENP +C YMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEDVWRAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMIKKRYMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 78.9518 bits (193), Expect = 5.087e-105
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQ+LFGDGAAA+
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAI 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_PERFR (Chalcone synthase OS=Perilla frutescens GN=CHS PE=2 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 6.636e-105
Identity = 156/181 (86.19%), Postives = 171/181 (94.48%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            M TV++IR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH T+LKEKFKRMC+KSMI+KRY++LTEE LKENPNM AYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLR+AKDLAENN
Sbjct:    1 MVTVEDIRRAQRAEGPATVMAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMCEKSMIRKRYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENN 181          

HSP 2 Score: 77.0258 bits (188), Expect = 6.636e-105
Identity = 37/40 (92.50%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEITAVTFRGP+++HLDSLVGQALFGDGAAAV
Sbjct:  183 GARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS2_MAIZE (Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 1.130e-104
Identity = 155/180 (86.11%), Postives = 169/180 (93.89%), Query Frame = 3
Query:   57 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            TV+E+R AQRA GPATVLAIGTATPA+ V QADYPDYYFRITKSEH+T+LKEKFKRMCDKSMI+KRY++LTEE L ENP+MCAYMAPSLDARQD+VVVEVPKLGK AA KAIKEWGQPKS+ITHL+FCTTSGVDMPGADYQLTK +GLRPSV R MMYQQGCFAGGTVLR+AKDLAENNR
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSEHLTDLKEKFKRMCDKSMIRKRYMHLTEEFLAENPSMCAYMAPSLDARQDVVVVEVPKLGKAAAQKAIKEWGQPKSRITHLVFCTTSGVDMPGADYQLTKALGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNR 186          

HSP 2 Score: 77.411 bits (189), Expect = 1.130e-104
Identity = 37/41 (90.24%), Postives = 41/41 (100.00%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+++HLDSLVGQALFGDGAAAV
Sbjct:  186 RGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAV 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_RAPSA (Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 1.130e-104
Identity = 156/181 (86.19%), Postives = 170/181 (93.92%), Query Frame = 3
Query:   54 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            +++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+++LTEE LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNR
Sbjct:    6 SSLDEIRKAQRADGPAGILAIGTANPANHVLQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNR 186          

HSP 2 Score: 77.0258 bits (188), Expect = 1.130e-104
Identity = 37/41 (90.24%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVLVVCSEITAVTFRGP+DTHLDSLVGQALF DGAAA+
Sbjct:  186 RGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAL 226          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHS6_IPOBA (Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DII PE=2 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 1.130e-104
Identity = 155/182 (85.16%), Postives = 169/182 (92.86%), Query Frame = 3
Query:   51 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 596
            M TV+E+R AQRA+GPAT+LAIGTATPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRY++LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 77.0258 bits (188), Expect = 1.130e-104
Identity = 36/41 (87.80%), Postives = 40/41 (97.56%), Query Frame = 2
Query:  593 QGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            +GARVL+VCSEIT VTFRGP++THLDSLVGQALFGDGAAAV
Sbjct:  182 KGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAV 222          
BLAST of FC876220 vs. ExPASy Swiss-Prot
Match: CHSY_PETCR (Chalcone synthase OS=Petroselinum crispum GN=CHS PE=3 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 1.474e-104
Identity = 154/180 (85.56%), Postives = 170/180 (94.44%), Query Frame = 3
Query:   54 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYIYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 593
            A ++EIRN QRA GPA +LAIGTATP++ V QADYPDYYFRIT SEHMT+LK KFKRMC+KSMI+KRY+++TEE LKENPN+CAY APSLDARQD+VVVEVP+LGKEAA+KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    7 AEIEEIRNRQRAQGPANILAIGTATPSNCVYQADYPDYYFRITNSEHMTDLKLKFKRMCEKSMIRKRYMHITEEYLKENPNVCAYEAPSLDARQDLVVVEVPRLGKEAASKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 186          

HSP 2 Score: 78.5666 bits (192), Expect = 1.474e-104
Identity = 38/40 (95.00%), Postives = 40/40 (100.00%), Query Frame = 2
Query:  596 GARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 715
            GARVLVVCSEITAVTFRGP+D+HLDSLVGQALFGDGAAAV
Sbjct:  188 GARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAV 227          
The following BLAST results are available for this feature:
BLAST of FC876220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS7_PICMA2.290e-10585.16Chalcone synthase 7 OS=Picea mariana GN=CSF7 PE=2 ... [more]
CHS1_CITSI3.899e-10585.16Chalcone synthase 1 OS=Citrus sinensis GN=CHS1 PE=... [more]
CHSY_CHRAE5.086e-10585.64Chalcone synthase OS=Chrysosplenium americanum GN=... [more]
CHSA_PETHY5.087e-10585.71Chalcone synthase A OS=Petunia hybrida GN=CHSA PE=... [more]
CHS3_CAMSI5.087e-10586.26Chalcone synthase 3 OS=Camellia sinensis GN=CHS3 P... [more]
CHSY_PERFR6.636e-10586.19Chalcone synthase OS=Perilla frutescens GN=CHS PE=... [more]
CHS2_MAIZE1.130e-10486.11Chalcone synthase C2 OS=Zea mays GN=C2 PE=3 SV=1[more]
CHSY_RAPSA1.130e-10486.19Chalcone synthase OS=Raphanus sativus GN=CHS PE=2 ... [more]
CHS6_IPOBA1.130e-10485.16Chalcone synthase DII OS=Ipomoea batatas GN=CHS-DI... [more]
CHSY_PETCR1.474e-10485.56Chalcone synthase OS=Petroselinum crispum GN=CHS P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H05EF DevOvary1 Citrus clementina cDNA clone C32001H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876220 ID=FC876220|Name=FC876220|organism=Citrus clementina|type=EST|length=716bp
AACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGAA
ATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGC
CACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAGG
CTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACG
GAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGAA
GCGTTACATATACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGT
GCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGGTC
GAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAATG
GGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCCG
GCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCTG
CGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCGG
CGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGCGC
TCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGGCC
CTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTTCGGTGAT
GGTGCTGCTGCTGTGA
back to top