FC876221

Overview
NameFC876221
Unique NameFC876221
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:7..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_PUELO (Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 2.315e-112
Identity = 199/222 (89.64%), Postives = 210/222 (94.59%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTA P + V+Q+ YPDYYFRIT SEHMTELKEKF+RMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSL ARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTK +GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVSVAEIRQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_PHAVU (Chalcone synthase 17 OS=Phaseolus vulgaris GN=CHS17 PE=2 SV=1)

HSP 1 Score: 404.445 bits (1038), Expect = 3.024e-112
Identity = 198/222 (89.19%), Postives = 211/222 (95.05%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTATP++ V+Q+ YPDYYFRIT SEHMT+LKEKF+RMCDKSMIKKRYM+L EEILKENPNMCAYMAPSL ARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVSVSEIRQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKKRYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_ANTMA (Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 6.736e-112
Identity = 198/222 (89.19%), Postives = 210/222 (94.59%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E+R AQRA+GPATVLAIGTATPA+ V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKS IK+RYM+LTEEILKENP MC YMAPSL ARQDIVVVEVP+LGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLR+AKDLAENN GARVLVVCSEITAVTFRGPADTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVTVEEVRRAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSNIKRRYMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_CASGL (Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 6.736e-112
Identity = 195/222 (87.84%), Postives = 211/222 (95.05%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E+R AQRA+GPATVLAIGTATP + ++Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYMYLTEEILKE+PNMCAYMAPSL ARQD+VVVE+PKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVTVEEVRKAQRAEGPATVLAIGTATPPNCLDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKEHPNMCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAI 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_VITVI (Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 8.797e-112
Identity = 198/222 (89.19%), Postives = 210/222 (94.59%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPATVLAIGTATPA+ V QADYPDYYFRIT SEHMTELKEKFKRMC+KSMI KRYM+LTEEILKENPN+CAYMAPSL ARQD+VVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKR MMYQQGCFAGGTVLRLAKDLAENN G+RVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_CAMSI (Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 PE=2 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 1.501e-111
Identity = 196/222 (88.29%), Postives = 209/222 (94.14%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV++IR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH  ELKEKFKRMCDKSMIKKRYMYLTEEILKENP +C YMAPSL ARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVTVEDIRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKKRYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAI 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_VIGUN (Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 2.560e-111
Identity = 196/222 (88.29%), Postives = 211/222 (95.05%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTATP + V+Q+ YPDYYFRIT SEHMT+LKEKF+RMCDKSMIKKRYM++TEEILKENP+MCAYMAPSL ARQDIVVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVSVSEIRQAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKKRYMHVTEEILKENPSMCAYMAPSLDARQDIVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_HYPAN (Chalcone synthase OS=Hypericum androsaemum PE=1 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 3.343e-111
Identity = 195/222 (87.84%), Postives = 206/222 (92.79%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E+R AQRA+GPATV+AIGTA P + V+QA YPDYYFRIT SEH  ELKEKF+RMCDKS IKKRYMYL EE+LKENPNMCAYMAPSL ARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVTVEEVRKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKKRYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAI 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSB_PEA (Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE=3 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 3.343e-111
Identity = 197/222 (88.74%), Postives = 210/222 (94.59%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV EIR AQ+A+GPATVLAIGTATP + V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYM+LTEEILKENP++C YMAPSL ARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVTVDEIRQAQKAEGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS6_SOYBN (Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 3.343e-111
Identity = 196/222 (88.29%), Postives = 210/222 (94.59%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT S+HM ELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYM PSL ARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN GARVLVVCSEITAVTFRGP+DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSDHMNELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMEPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNTGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAV 222          
The following BLAST results are available for this feature:
BLAST of FC876221 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 146
Match NameE-valueIdentityDescription
CHSY_PUELO2.315e-11289.64Chalcone synthase OS=Pueraria lobata GN=CHS PE=2 S... [more]
CHSY_PHAVU3.024e-11289.19Chalcone synthase 17 OS=Phaseolus vulgaris GN=CHS1... [more]
CHSY_ANTMA6.736e-11289.19Chalcone synthase OS=Antirrhinum majus GN=CHS PE=3... [more]
CHS1_CASGL6.736e-11287.84Chalcone synthase OS=Casuarina glauca GN=CHS1 PE=2... [more]
CHSY_VITVI8.797e-11289.19Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV... [more]
CHS1_CAMSI1.501e-11188.29Chalcone synthase 1 OS=Camellia sinensis GN=CHS1 P... [more]
CHSY_VIGUN2.560e-11188.29Chalcone synthase OS=Vigna unguiculata GN=CHS PE=2... [more]
CHSY_HYPAN3.343e-11187.84Chalcone synthase OS=Hypericum androsaemum PE=1 SV... [more]
CHSB_PEA3.343e-11188.74Chalcone synthase 1B OS=Pisum sativum GN=CHS-1B PE... [more]
CHS6_SOYBN3.343e-11188.29Chalcone synthase 6 OS=Glycine max GN=CHS6 PE=3 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H09EF DevOvary1 Citrus clementina cDNA clone C32001H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876221 ID=FC876221|Name=FC876221|organism=Citrus clementina|type=EST|length=718bp
GAACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGA
AATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGG
CCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAG
GCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGAC
GGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGA
AGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATG
TGCGCTTACATGGCTCCATCACTCGGCGCACGCCAAGACATTGTGGTGGT
CGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAAT
GGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCC
GGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCT
GCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCG
GCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGCTTTGTTCGGTG
ATGGTGCTGCTGCTGTGA
back to top