FC876221

Overview
NameFC876221
Unique NameFC876221
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:7..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS3_GERHY (Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=2 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.315e-107
Identity = 189/219 (86.30%), Postives = 206/219 (94.06%), Query Frame = 1
Query:   61 VQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            V+ IR AQRA+GPAT+LAIGTATPA+ V QADYPDYYFR+T+SEHM +LKEKF+RMCDKSMI+KRYM++TEE LKENP+MC +MAPSL ARQD+VVVEVPKLGKEAATKAIKEWG PKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP + HLDSLVG ALFGDGAAAV
Sbjct:   10 VETIRKAQRAEGPATILAIGTATPANCVYQADYPDYYFRVTESEHMVDLKEKFQRMCDKSMIRKRYMHITEEFLKENPSMCKFMAPSLDARQDLVVVEVPKLGKEAATKAIKEWGFPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPNEGHLDSLVGQALFGDGAAAV 228          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_TRISU (Chalcone synthase 1 OS=Trifolium subterraneum GN=CHS1 PE=3 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.315e-107
Identity = 189/222 (85.14%), Postives = 205/222 (92.34%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTA P + V QA YPD+YF+IT SEH  ELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSL ARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVSVAEIRKAQRAEGPATILAIGTANPPNRVEQATYPDFYFKITNSEHKVELKEKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_PINST (Chalcone synthase OS=Pinus strobus GN=CHS PE=2 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 1.717e-107
Identity = 187/222 (84.23%), Postives = 208/222 (93.69%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            MA ++  R AQRADGPAT+LAIGTATP ++V+Q+ YPDYYF+IT SEHMTELKEKF+RMCDKS IKKRYMYLTEEIL ENP++CAYMAPSL ARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITH+IFCTTSGVDMPGADYQ+TKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDS+VG ALFGDGA A+
Sbjct:    6 MADLEAFRKAQRADGPATILAIGTATPPNAVDQSTYPDYYFKITNSEHMTELKEKFRRMCDKSGIKKRYMYLTEEILNENPSVCAYMAPSLDARQDMVVVEVPRLGKEAAAKAIKEWGQPKSKITHVIFCTTSGVDMPGADYQMTKLLGLRPSVKRVMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSMVGQALFGDGARAL 227          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSD_IPONI (Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 1.717e-107
Identity = 188/222 (84.68%), Postives = 206/222 (92.79%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E+R AQRA+GPAT+LAIGTATPA+ V+Q+ YPDYYFRIT S+HMT+LK+KF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSL ARQDIVVVEVPKLGKEAA  AIKEWGQPKSKITH+IFCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENNK ARVLVVCSEIT VTFRGP +THLDSLVG ALFGDGAAA+
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVIFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKAARVLVVCSEITVVTFRGPNETHLDSLVGQALFGDGAAAI 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS4_PEA (Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 1.717e-107
Identity = 188/222 (84.68%), Postives = 206/222 (92.79%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YFRIT SEH  ELK+KF+RMCDKSMI +RYMYLTEEILKENP++C YMAPSL ARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFRITNSEHKIELKQKFQRMCDKSMINRRYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_PEA (Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 1.717e-107
Identity = 188/222 (84.68%), Postives = 206/222 (92.79%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR  QRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSL ARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVSVSEIRKPQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS3_IPOBA (Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF3 PE=2 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 2.242e-107
Identity = 189/222 (85.14%), Postives = 203/222 (91.44%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV E+R AQRA+GPAT+LAIGTATPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSL ARQDI VVEVPKLGKEAA  AIK WGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++ HLDSLVG ALFGDGAAAV
Sbjct:    1 MVTVGEVRKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKGWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSEAHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_SOLLC (Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS1 PE=2 SV=2)

HSP 1 Score: 387.882 bits (995), Expect = 2.929e-107
Identity = 188/222 (84.68%), Postives = 204/222 (91.89%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E R AQRA+GPAT+LAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRYM+LTEEILKENPNMCAYMAPSL ARQDIVVVEVPKLGK    KAIKEWGQPKSKITHL+FCTTSGVDMP  DYQL KL+ +RPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+++HLDSLVG ALFGDGAAA+
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKRGTQKAIKEWGQPKSKITHLVFCTTSGVDMPACDYQLAKLLPVRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAI 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_DIAMO (Chalcone synthase OS=Dianthus monspessulanus GN=CHS PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 4.995e-107
Identity = 185/222 (83.33%), Postives = 205/222 (92.34%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            MA+++EIR AQRADGPAT+LAIGTATP +++ QADYPDYYFR+TKSEHMTELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+C YM  SL  RQD+VV EVP+LGKEAA KAIKEWGQPKSKITH+I CTTSGVDMPGADYQLTKL+GLRPSV+RFM+YQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITA+ FRGP +  LDS+VG ALFGDGA A+
Sbjct:    1 MASIEEIRQAQRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLCEYMGSSLDTRQDMVVSEVPRLGKEAAVKAIKEWGQPKSKITHVIMCTTSGVDMPGADYQLTKLLGLRPSVRRFMLYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAICFRGPTEAALDSMVGQALFGDGAGAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS2_PEA (Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 4.995e-107
Identity = 187/222 (84.23%), Postives = 205/222 (92.34%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RYMYLTE+ILKENP++C YMAPSL ARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTV RLAKDLAENNK ARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVTVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEDILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVFRLAKDLAENNKNARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
The following BLAST results are available for this feature:
BLAST of FC876221 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 146
Match NameE-valueIdentityDescription
CHS3_GERHY1.315e-10786.30Chalcone synthase 3 OS=Gerbera hybrida GN=CHS3 PE=... [more]
CHS1_TRISU1.315e-10785.14Chalcone synthase 1 OS=Trifolium subterraneum GN=C... [more]
CHSY_PINST1.717e-10784.23Chalcone synthase OS=Pinus strobus GN=CHS PE=2 SV=... [more]
CHSD_IPONI1.717e-10784.68Chalcone synthase D OS=Ipomoea nil GN=CHSD PE=2 SV... [more]
CHS4_PEA1.717e-10784.68Chalcone synthase 4 OS=Pisum sativum GN=CHS4 PE=3 ... [more]
CHS1_PEA1.717e-10784.68Chalcone synthase 1 OS=Pisum sativum GN=CHS1 PE=2 ... [more]
CHS3_IPOBA2.242e-10785.14Chalcone synthase LF3 OS=Ipomoea batatas GN=CHS-LF... [more]
CHS1_SOLLC2.929e-10784.68Chalcone synthase 1 OS=Solanum lycopersicum GN=CHS... [more]
CHSY_DIAMO4.995e-10783.33Chalcone synthase OS=Dianthus monspessulanus GN=CH... [more]
CHS2_PEA4.995e-10784.23Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H09EF DevOvary1 Citrus clementina cDNA clone C32001H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876221 ID=FC876221|Name=FC876221|organism=Citrus clementina|type=EST|length=718bp
GAACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGA
AATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGG
CCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAG
GCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGAC
GGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGA
AGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATG
TGCGCTTACATGGCTCCATCACTCGGCGCACGCCAAGACATTGTGGTGGT
CGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAAT
GGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCC
GGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCT
GCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCG
GCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGCTTTGTTCGGTG
ATGGTGCTGCTGCTGTGA
back to top