FC876221

Overview
NameFC876221
Unique NameFC876221
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:7..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS2_DAUCA (Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 6.524e-107
Identity = 188/221 (85.07%), Postives = 205/221 (92.76%), Query Frame = 1
Query:   55 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            A ++EIR  QRA GPA +LAIGTATP++ V QADYPDYYFRIT SEHM++LK KFKRMC+KSMI+KRYM++TEE LKENPN+CAY APSL ARQD+VVVEVP+LGKEAA KAIKEWG PKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN GARVLVVCSEITAVTFRGP+D+HLDSLVG ALFGDGAAAV
Sbjct:    6 AEIEEIRKRQRAQGPANILAIGTATPSNCVYQADYPDYYFRITNSEHMSDLKLKFKRMCEKSMIRKRYMHITEEYLKENPNVCAYEAPSLDARQDLVVVEVPRLGKEAAAKAIKEWGHPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNTGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAV 226          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_ARAAL (Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 8.521e-107
Identity = 187/220 (85.00%), Postives = 204/220 (92.73%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            +++EIR AQRADGPA +L IGTA P + V QA+YPDYYFRIT S+HMT+LKEKFKRMCDKSMI+KR+M+LTEE LKENP MCAYMAPSL  RQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVG ALF DGAAA+
Sbjct:    4 SLEEIRKAQRADGPAGILGIGTANPPNHVLQAEYPDYYFRITNSDHMTDLKEKFKRMCDKSMIRKRHMHLTEEFLKENPKMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAL 223          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_CICAR (Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 8.521e-107
Identity = 186/222 (83.78%), Postives = 205/222 (92.34%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT+LAIGTA P++ V Q+ YPD+YF+IT SEH  ELK+KF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSL  RQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPSNRVEQSTYPDFYFKITNSEHKVELKQKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDVRQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_ARATH (Chalcone synthase OS=Arabidopsis thaliana GN=CHS PE=1 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 1.113e-106
Identity = 187/221 (84.62%), Postives = 205/221 (92.76%), Query Frame = 1
Query:   55 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            +++ EIR AQRADGPA +LAIGTA P + V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LKENP+MCAYMAPSL  RQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVG ALF DGAAA+
Sbjct:    7 SSLDEIRQAQRADGPAGILAIGTANPENHVLQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKENPHMCAYMAPSLDTRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRIAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAL 227          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_SECCE (Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.479e-106
Identity = 189/220 (85.91%), Postives = 206/220 (93.64%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+E+R AQRA+GPATVLAIGTATPA+ V QADYPDYYF+ITKS+HM +LKEKFKRMCDKS I+KRYM+LTEEIL++NPNMCAYMAPSL ARQDIVVVEVPKLGK AA KAIKEWGQP+SKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP +   DSLVG ALFGDGAAAV
Sbjct:    6 TVEEVRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILQDNPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPHE--FDSLVGQALFGDGAAAV 223          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS5_MEDSA (Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2 PE=2 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 5.523e-106
Identity = 187/222 (84.23%), Postives = 204/222 (91.89%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIRNAQRA+GPAT LAIGTA P + V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C  MAPSL A QD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVSVSEIRNAQRAEGPATTLAIGTANPTNCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEIMAPSLDAWQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_DIACA (Chalcone synthase OS=Dianthus caryophyllus GN=CHS PE=2 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 1.607e-105
Identity = 183/222 (82.43%), Postives = 203/222 (91.44%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            MA+++EIR A RADGPAT+LAIGTATP +++ QADYPDYYFR+TKSEHMTELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+C YM  SL  RQD+VV EVP+LGKEAA KAIKEWGQPKSKITH+I CTTSGVDMPGADYQLTKL+GLRPSV+RFM+YQQGCFAGGTVLRLAKDLAENNK ARVLVVCSEITA+ FRGP +  LDS+VG ALFGDGA A+
Sbjct:    1 MASIEEIRQAPRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLCEYMGSSLDTRQDMVVSEVPRLGKEAAVKAIKEWGQPKSKITHVIMCTTSGVDMPGADYQLTKLLGLRPSVRRFMLYQQGCFAGGTVLRLAKDLAENNKDARVLVVCSEITAICFRGPTEAALDSMVGQALFGDGAGAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_MEDSA (Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=2 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 6.107e-105
Identity = 184/222 (82.88%), Postives = 202/222 (90.99%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V EIR AQRA+GPAT++AIGTA PA+ V Q+ YPD+YF+IT SEH  ELKEKF+RMCDKSMIK+RYMYLTEEILK+NP +C YMAPSL ARQD+ VV VP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE T VTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVSVAEIRQAQRAEGPATIMAIGTANPANCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKDNPRVCEYMAPSLAARQDMAVVVVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEETPVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_MAIZE (Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.172e-102
Identity = 180/219 (82.19%), Postives = 201/219 (91.78%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAA 714
            TV E+R  QRA GPATVLAIGTATPA+ V QADYPDYYFRITKS+H+T+LKEKFKRMCDKSMI+KRYM+LTEE L ENP+MCAYMAPSL ARQD+VV EVPKLGK AA +AIKEWGQPKS+ITHL+FCTTSGVDMPGADYQLTK +GLR  V R MMYQQGCFAGGTVLR+AKD+AENN+GARV+VVCSEITAVTFRGP+++H+DSLVG ALFGDGAAA
Sbjct:    7 TVDEVRKGQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSDHLTDLKEKFKRMCDKSMIRKRYMHLTEEFLSENPSMCAYMAPSLDARQDVVVTEVPKLGKAAAQEAIKEWGQPKSRITHLVFCTTSGVDMPGADYQLTKALGLR-VVNRLMMYQQGCFAGGTVLRVAKDVAENNRGARVMVVCSEITAVTFRGPSESHVDSLVGQALFGDGAAA 224          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_ONOVI (Chalcone synthase OS=Onobrychis viciifolia GN=CHS PE=2 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 2.837e-102
Identity = 181/222 (81.53%), Postives = 197/222 (88.74%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M  V E R  QRA+GP T+ AI TA P + V Q+ YPD+YF+IT SEH  ELKEKF+RM DKSMIK+RYMYLTEEILKENPN+C YMAPSL ARQD+ VVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GLRP VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVG ALFGDGAAA+
Sbjct:    1 MVDVAESRRTQRAEGPRTIFAIATANPPNCVEQSTYPDFYFKITNSEHKVELKEKFQRMDDKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMFVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPHVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
The following BLAST results are available for this feature:
BLAST of FC876221 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 146
Match NameE-valueIdentityDescription
CHS2_DAUCA6.524e-10785.07Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 ... [more]
CHSY_ARAAL8.521e-10785.00Chalcone synthase OS=Arabis alpina GN=CHS PE=3 SV=... [more]
CHS1_CICAR8.521e-10783.78Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=... [more]
CHSY_ARATH1.113e-10684.62Chalcone synthase OS=Arabidopsis thaliana GN=CHS P... [more]
CHS1_SECCE2.479e-10685.91Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3... [more]
CHS5_MEDSA5.523e-10684.23Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2... [more]
CHSY_DIACA1.607e-10582.43Chalcone synthase OS=Dianthus caryophyllus GN=CHS ... [more]
CHS1_MEDSA6.107e-10582.88Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=... [more]
CHS1_MAIZE2.172e-10282.19Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV... [more]
CHSY_ONOVI2.837e-10281.53Chalcone synthase OS=Onobrychis viciifolia GN=CHS ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H09EF DevOvary1 Citrus clementina cDNA clone C32001H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876221 ID=FC876221|Name=FC876221|organism=Citrus clementina|type=EST|length=718bp
GAACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGA
AATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGG
CCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAG
GCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGAC
GGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGA
AGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATG
TGCGCTTACATGGCTCCATCACTCGGCGCACGCCAAGACATTGTGGTGGT
CGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAAT
GGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCC
GGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCT
GCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCG
GCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGCTTTGTTCGGTG
ATGGTGCTGCTGCTGTGA
back to top