FC876222

Overview
NameFC876222
Unique NameFC876222
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:4..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS6_TRISU (Chalcone synthase 6 OS=Trifolium subterraneum GN=CHS6 PE=2 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 5.948e-108
Identity = 190/222 (85.59%), Postives = 206/222 (92.79%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M +V EIR AQRA+GPAT+LAIGTA PA+ V QA YPD+YF+IT SEH TELKEKF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GL P VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQAL  DGAAA+
Sbjct:    1 MVSVAEIRKAQRAEGPATILAIGTANPANKVEQATYPDFYFKITNSEHKTELKEKFQRMCDKSMIKSRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS1_SINAL (Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 5.948e-108
Identity = 190/221 (85.97%), Postives = 207/221 (93.67%), Query Frame = 1
Query:   58 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            +++ EIR AQRADGPA +LAIGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKFKRMCDKS I+KR+M+LTEE LK+NPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GL PSVKR MMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQAL  DGAAA+
Sbjct:    7 SSLDEIRKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKRHMHLTEEFLKDNPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAL 227          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHSY_CHRAE (Chalcone synthase OS=Chrysosplenium americanum GN=CHS PE=2 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 7.769e-108
Identity = 190/221 (85.97%), Postives = 207/221 (93.67%), Query Frame = 1
Query:   58 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            A ++EIRNAQRA+GPAT+LAIGTATPA+ V QADYPD+YFRIT SEH TELKEKF+RMCDKSMIKKRYM+LTE++LKENP MC YMAPSLDARQD+VVVE+ KLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL PSVKR MMYQQGCF GGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQAL  DGAAA+
Sbjct:    5 ALMEEIRNAQRAEGPATILAIGTATPANCVIQADYPDFYFRITNSEHKTELKEKFQRMCDKSMIKKRYMHLTEDLLKENPKMCEYMAPSLDARQDMVVVEIRKLGKEAAVKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFPGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAL 225          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS2_IPOBA (Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF2 PE=2 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 7.769e-108
Identity = 189/222 (85.14%), Postives = 204/222 (91.89%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSGVDMPGADYQLTKL+GL PSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVGQAL  DGAAAV
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGVDMPGADYQLTKLLGLSPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAV 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHSY_PETCR (Chalcone synthase OS=Petroselinum crispum GN=CHS PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 1.015e-107
Identity = 190/221 (85.97%), Postives = 207/221 (93.67%), Query Frame = 1
Query:   58 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            A ++EIRN QRA GPA +LAIGTATP++ V QADYPDYYFRIT SEHMT+LK KFKRMC+KSMI+KRYM++TEE LKENPN+CAY APSLDARQD+VVVEVP+LGKEAA+KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GL PSVKRFMMYQQGCFAGGTVLRLAKDLAENN GARVLVVCSEITAVTFRGP+D+HLDSLVGQAL  DGAAAV
Sbjct:    7 AEIEEIRNRQRAQGPANILAIGTATPSNCVYQADYPDYYFRITNSEHMTDLKLKFKRMCEKSMIRKRYMHITEEYLKENPNVCAYEAPSLDARQDLVVVEVPRLGKEAASKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNAGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAV 227          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHSY_MATIN (Chalcone synthase OS=Matthiola incana GN=CHS PE=2 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.325e-107
Identity = 189/220 (85.91%), Postives = 206/220 (93.64%), Query Frame = 1
Query:   61 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            ++ EIR AQRADGPA +L IGTA PA+ V QA+YPDYYFRIT SEHMT+LKEKF+RMCDKSMI+KR+M+LTE+ LKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA +AIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL PSVKR MMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP+DTHLDSLVGQAL  DGAAA+
Sbjct:    7 SLDEIRKAQRADGPAGILGIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFQRMCDKSMIRKRHMHLTEDFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVRAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAL 226          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS8_IPOBA (Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DIV PE=2 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.325e-107
Identity = 188/222 (84.68%), Postives = 204/222 (91.89%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSG+DMPGADYQLTKL+GL PSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVGQAL  DGAAAV
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGIDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAV 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS6_PEA (Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.325e-107
Identity = 189/222 (85.14%), Postives = 207/222 (93.24%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M +V EIR AQRA+GPAT+LAIGTATPA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RYMYLTEEILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GL P VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQAL  DGAAA+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTATPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEEILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS1_IPOBA (Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF1 PE=2 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 1.325e-107
Identity = 188/222 (84.68%), Postives = 204/222 (91.89%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M TV+E+R AQRA+GPAT+LAIGT TPA+ VNQ+ YPDYYFRIT SEH TELKEKF+RMCDKSMI KRYM+LTEEILKENP+ C YMAPSLDARQDI VVEVPKLGKEAA  AIKEWGQPKSKITH++FCTTSG+DMPGADYQLTKL+GL PSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVL+VCSEIT VTFRGP++THLDSLVGQAL  DGAAAV
Sbjct:    1 MVTVEEVRKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKRYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVVFCTTSGIDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLIVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAV 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHSY_CATRO (Chalcone synthase OS=Catharanthus roseus GN=CHS PE=2 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 1.731e-107
Identity = 191/222 (86.04%), Postives = 208/222 (93.69%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M  V+EIRNAQRA GPATVLAIGT+TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMC+KSMIKKRYM+LTEEIL+ENPN+CAYMAPSLDARQ+IVVVEVPKLGKEAA KAIKEWGQ KSKITHL+FCTTSGVDMPGADYQLTKL+GL  SVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+++HLDSLVGQAL  DGAAA+
Sbjct:    1 MVNVEEIRNAQRAQGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRYMHLTEEILQENPNICAYMAPSLDARQNIVVVEVPKLGKEAAQKAIKEWGQSKSKITHLVFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAI 222          
The following BLAST results are available for this feature:
BLAST of FC876222 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS6_TRISU5.948e-10885.59Chalcone synthase 6 OS=Trifolium subterraneum GN=C... [more]
CHS1_SINAL5.948e-10885.97Chalcone synthase 1 OS=Sinapis alba GN=CHS1 PE=2 S... [more]
CHSY_CHRAE7.769e-10885.97Chalcone synthase OS=Chrysosplenium americanum GN=... [more]
CHS2_IPOBA7.769e-10885.14Chalcone synthase LF2 OS=Ipomoea batatas GN=CHS-LF... [more]
CHSY_PETCR1.015e-10785.97Chalcone synthase OS=Petroselinum crispum GN=CHS P... [more]
CHSY_MATIN1.325e-10785.91Chalcone synthase OS=Matthiola incana GN=CHS PE=2 ... [more]
CHS8_IPOBA1.325e-10784.68Chalcone synthase DIV OS=Ipomoea batatas GN=CHS-DI... [more]
CHS6_PEA1.325e-10785.14Chalcone synthase 6 OS=Pisum sativum GN=CHS6 PE=2 ... [more]
CHS1_IPOBA1.325e-10784.68Chalcone synthase LF1 OS=Ipomoea batatas GN=CHS-LF... [more]
CHSY_CATRO1.731e-10786.04Chalcone synthase OS=Catharanthus roseus GN=CHS PE... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H10EF DevOvary1 Citrus clementina cDNA clone C32001H10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876222 ID=FC876222|Name=FC876222|organism=Citrus clementina|type=EST|length=721bp
GGCACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACT
TGAAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCC
CGGCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAAC
CAGGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATAT
GACGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTA
AGAAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAAC
ATGTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGT
GGTCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAG
AATGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACC
TCCGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGG
CCTGCCCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCG
CCGGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAG
GGCGCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCG
CGGCCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGNTTC
GTGATGGTGCTGCTGCTGTGA
back to top