FC876222

Overview
NameFC876222
Unique NameFC876222
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length721
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:4..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHSY_DIAMO (Chalcone synthase OS=Dianthus monspessulanus GN=CHS PE=2 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 5.567e-106
Identity = 184/222 (82.88%), Postives = 204/222 (91.89%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            MA+++EIR AQRADGPAT+LAIGTATP +++ QADYPDYYFR+TKSEHMTELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+C YM  SLD RQD+VV EVP+LGKEAA KAIKEWGQPKSKITH+I CTTSGVDMPGADYQLTKL+GL PSV+RFM+YQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITA+ FRGP +  LDS+VGQAL  DGA A+
Sbjct:    1 MASIEEIRQAQRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLCEYMGSSLDTRQDMVVSEVPRLGKEAAVKAIKEWGQPKSKITHVIMCTTSGVDMPGADYQLTKLLGLRPSVRRFMLYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAICFRGPTEAALDSMVGQALFGDGAGAL 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS2_PEA (Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 5.567e-106
Identity = 186/222 (83.78%), Postives = 204/222 (91.89%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M TV EIR AQRA+GPAT+LAIGTA PA+ V Q+ YPD+YF+IT SEH T LKEKF+RMCDKSMIK+RYMYLTE+ILKENP++C YMAPSLDARQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GL P VKR+MMYQQGCFAGGTV RLAKDLAENNK ARVLVVCSE+TAVTFRGP+DTHLDSLVGQAL  DGAAA+
Sbjct:    1 MVTVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKTVLKEKFQRMCDKSMIKRRYMYLTEDILKENPSLCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVFRLAKDLAENNKNARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS2_DAUCA (Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 7.271e-106
Identity = 187/221 (84.62%), Postives = 204/221 (92.31%), Query Frame = 1
Query:   58 ATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            A ++EIR  QRA GPA +LAIGTATP++ V QADYPDYYFRIT SEHM++LK KFKRMC+KSMI+KRYM++TEE LKENPN+CAY APSLDARQD+VVVEVP+LGKEAA KAIKEWG PKSKITHLIFCTTSGVDMPGADYQLTKL+GL PSVKRFMMYQQGCFAGGTVLRLAKDLAENN GARVLVVCSEITAVTFRGP+D+HLDSLVGQAL  DGAAAV
Sbjct:    6 AEIEEIRKRQRAQGPANILAIGTATPSNCVYQADYPDYYFRITNSEHMSDLKLKFKRMCEKSMIRKRYMHITEEYLKENPNVCAYEAPSLDARQDLVVVEVPRLGKEAAAKAIKEWGHPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNTGARVLVVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAV 226          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS1_CICAR (Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=2 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 9.496e-106
Identity = 185/222 (83.33%), Postives = 204/222 (91.89%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M +V EIR AQRA+GPAT+LAIGTA P++ V Q+ YPD+YF+IT SEH  ELK+KF+RMCDKSMIK RYMYLTEEILKENP++C YMAPSLD RQD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GL P VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQAL  DGAAA+
Sbjct:    1 MVSVSEIRKAQRAEGPATILAIGTANPSNRVEQSTYPDFYFKITNSEHKVELKQKFQRMCDKSMIKSRYMYLTEEILKENPSVCEYMAPSLDVRQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS1_SECCE (Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 2.763e-105
Identity = 188/220 (85.45%), Postives = 205/220 (93.18%), Query Frame = 1
Query:   61 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            TV+E+R AQRA+GPATVLAIGTATPA+ V QADYPDYYF+ITKS+HM +LKEKFKRMCDKS I+KRYM+LTEEIL++NPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+SKITHL+FCTTSGVDMPGADYQLTK++GL PSVKR MMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP +   DSLVGQAL  DGAAAV
Sbjct:    6 TVEEVRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILQDNPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPHE--FDSLVGQALFGDGAAAV 223          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS5_MEDSA (Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2 PE=2 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 6.155e-105
Identity = 186/222 (83.78%), Postives = 203/222 (91.44%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M +V EIRNAQRA+GPAT LAIGTA P + V Q+ YPD+YF+IT SEH TELKEKF+RMCDKSMIK+RYMYLTEEILKENP++C  MAPSLDA QD+VVVEVP+LGKEAA KAIKEWGQPKSKITHLI CTTSGVDMPGADYQLTKL+GL P VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE+TAVTFRGP+DTHLDSLVGQAL  DGAAA+
Sbjct:    1 MVSVSEIRNAQRAEGPATTLAIGTANPTNCVEQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKRRYMYLTEEILKENPSVCEIMAPSLDAWQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHSY_DIACA (Chalcone synthase OS=Dianthus caryophyllus GN=CHS PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 1.791e-104
Identity = 182/222 (81.98%), Postives = 202/222 (90.99%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            MA+++EIR A RADGPAT+LAIGTATP +++ QADYPDYYFR+TKSEHMTELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+C YM  SLD RQD+VV EVP+LGKEAA KAIKEWGQPKSKITH+I CTTSGVDMPGADYQLTKL+GL PSV+RFM+YQQGCFAGGTVLRLAKDLAENNK ARVLVVCSEITA+ FRGP +  LDS+VGQAL  DGA A+
Sbjct:    1 MASIEEIRQAPRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLCEYMGSSLDTRQDMVVSEVPRLGKEAAVKAIKEWGQPKSKITHVIMCTTSGVDMPGADYQLTKLLGLRPSVRRFMLYQQGCFAGGTVLRLAKDLAENNKDARVLVVCSEITAICFRGPTEAALDSMVGQALFGDGAGAL 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS1_MEDSA (Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=2 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 7.525e-103
Identity = 182/222 (81.98%), Postives = 200/222 (90.09%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M +V EIR AQRA+GPAT++AIGTA PA+ V Q+ YPD+YF+IT SEH  ELKEKF+RMCDKSMIK+RYMYLTEEILK+NP +C YMAPSL ARQD+ VV VP+LGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GL P VKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSE T VTFRGP+DTHLDSLVGQAL  DGAAA+
Sbjct:    1 MVSVAEIRQAQRAEGPATIMAIGTANPANCVEQSTYPDFYFKITNSEHKVELKEKFQRMCDKSMIKRRYMYLTEEILKDNPRVCEYMAPSLAARQDMAVVVVPRLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEETPVTFRGPSDTHLDSLVGQALFGDGAAAL 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHSD_PETHY (Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=3 SV=2)

HSP 1 Score: 369.007 bits (946), Expect = 1.419e-101
Identity = 182/222 (81.98%), Postives = 200/222 (90.09%), Query Frame = 1
Query:   55 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAAV 720
            M TV+E+RNAQRA+GPATVLAIGTATP++ V+Q+ YPDYYFRIT SEH TELKEKFKR+CDKSMIKKRYM+LTE+ILKENPN+C  MAPSLDAR +I  VEVPKLGKEAA KAI+EW QPKS+ITHL+FCTT+GV MPGAD+QLTKL+GL  SVKRFMM Q GCFAGGTVLRLAKDLAENNKGARVLVVCSEIT VTFRGP DTH DSLVGQAL  DGAAAV
Sbjct:    1 MVTVEEVRNAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITDSEHKTELKEKFKRICDKSMIKKRYMHLTEKILKENPNICESMAPSLDARTNIYAVEVPKLGKEAAEKAIEEWNQPKSRITHLVFCTTTGVSMPGADFQLTKLLGLGSSVKRFMMNQLGCFAGGTVLRLAKDLAENNKGARVLVVCSEITVVTFRGPNDTHFDSLVGQALFGDGAAAV 222          
BLAST of FC876222 vs. ExPASy Swiss-Prot
Match: CHS1_MAIZE (Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 2.421e-101
Identity = 179/219 (81.74%), Postives = 200/219 (91.32%), Query Frame = 1
Query:   61 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLPPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALXRDGAAA 717
            TV E+R  QRA GPATVLAIGTATPA+ V QADYPDYYFRITKS+H+T+LKEKFKRMCDKSMI+KRYM+LTEE L ENP+MCAYMAPSLDARQD+VV EVPKLGK AA +AIKEWGQPKS+ITHL+FCTTSGVDMPGADYQLTK +GL   V R MMYQQGCFAGGTVLR+AKD+AENN+GARV+VVCSEITAVTFRGP+++H+DSLVGQAL  DGAAA
Sbjct:    7 TVDEVRKGQRATGPATVLAIGTATPANCVYQADYPDYYFRITKSDHLTDLKEKFKRMCDKSMIRKRYMHLTEEFLSENPSMCAYMAPSLDARQDVVVTEVPKLGKAAAQEAIKEWGQPKSRITHLVFCTTSGVDMPGADYQLTKALGL-RVVNRLMMYQQGCFAGGTVLRVAKDVAENNRGARVMVVCSEITAVTFRGPSESHVDSLVGQALFGDGAAA 224          
The following BLAST results are available for this feature:
BLAST of FC876222 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHSY_DIAMO5.567e-10682.88Chalcone synthase OS=Dianthus monspessulanus GN=CH... [more]
CHS2_PEA5.567e-10683.78Chalcone synthase 2 OS=Pisum sativum GN=CHS2 PE=2 ... [more]
CHS2_DAUCA7.271e-10684.62Chalcone synthase 2 OS=Daucus carota GN=CHS2 PE=2 ... [more]
CHS1_CICAR9.496e-10683.33Chalcone synthase 1 OS=Cicer arietinum GN=CHS1 PE=... [more]
CHS1_SECCE2.763e-10585.45Chalcone synthase 1 OS=Secale cereale GN=CHS1 PE=3... [more]
CHS5_MEDSA6.155e-10583.78Chalcone synthase 4-2 OS=Medicago sativa GN=CHS4-2... [more]
CHSY_DIACA1.791e-10481.98Chalcone synthase OS=Dianthus caryophyllus GN=CHS ... [more]
CHS1_MEDSA7.525e-10381.98Chalcone synthase 1 OS=Medicago sativa GN=CHS1 PE=... [more]
CHSD_PETHY1.419e-10181.98Chalcone synthase D OS=Petunia hybrida GN=CHSD PE=... [more]
CHS1_MAIZE2.421e-10181.74Chalcone synthase WHP1 OS=Zea mays GN=WHP1 PE=3 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H10EF DevOvary1 Citrus clementina cDNA clone C32001H10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876222 ID=FC876222|Name=FC876222|organism=Citrus clementina|type=EST|length=721bp
GGCACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACT
TGAAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCC
CGGCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAAC
CAGGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATAT
GACGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTA
AGAAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAAC
ATGTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGT
GGTCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAG
AATGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACC
TCCGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGG
CCTGCCCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCG
CCGGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAG
GGCGCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCG
CGGCCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGNTTC
GTGATGGTGCTGCTGCTGTGA
back to top