FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PX_HORVU (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Hordeum vulgare GN=GAPC PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 1.901e-59
Identity = 110/146 (75.34%), Postives = 121/146 (82.88%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            MGK+KIGINGFGRIGRLVARV LQ DDVELVAVNDPFITT+YMTYM KYD+VHG WKH ++K+KDDKTLLFGEKPVTVFGVRNPEEIPW E GA+YVVESTGVFT               V+ISAPSKDAPMFVVGVNE +Y  ++
Sbjct:    1 MGKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTEYMTYMFKYDTVHGHWKHSDIKLKDDKTLLFGEKPVTVFGVRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEDKYTSDV 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PE_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 3 OS=Zea mays GN=GAPC3 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 3.242e-59
Identity = 111/146 (76.03%), Postives = 118/146 (80.82%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            M K+KIGINGFGRIGRLVARV LQ DDVELVAVNDPFI+TDYMTYM KYD+VHGQWKHHE+KVKD KTLLFGEK V VFG RNPEEIPW   GAEYVVESTGVFT               V+ISAPSKDAPMFVVGVNE EYK ++
Sbjct:    1 MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFISTDYMTYMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVAVFGCRNPEEIPWGSVGAEYVVESTGVFTDQEKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEKEYKSDI 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PD_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 2 OS=Zea mays GN=GAPC2 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 7.223e-59
Identity = 109/146 (74.66%), Postives = 120/146 (82.19%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            MGK+KIGINGFGRIGRLVARV LQ +DVELVAVNDPFITTDYMTYM KYD+VHGQWKH ++ +KD KTLLFGEKPVTVFG+RNPEEIPW E GAEYVVESTGVFT               V+ISAPSKDAPMFVVGVNE +Y  ++
Sbjct:    1 MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIALKDSKTLLFGEKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEDKYTSDV 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_PINSY (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pinus sylvestris GN=GAPC PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 9.434e-59
Identity = 108/145 (74.48%), Postives = 118/145 (81.38%), Query Frame = 3
Query:   75 GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            GK+KIGINGFGRIGRLVARV L RDD+ELV VNDPFI+TDYM+YM KYDSVHG+WKHHE+ VKD KTLLFGEK V VFG RNPEEIPW E GAEYVVESTGVFT               V+ISAPSKDAPMFVVGVNEH+YK ++
Sbjct:    5 GKIKIGINGFGRIGRLVARVALTRDDIELVGVNDPFISTDYMSYMFKYDSVHGKWKHHEVNVKDSKTLLFGEKSVAVFGCRNPEEIPWGEVGAEYVVESTGVFTDKEKASAHLKAGAKKVVISAPSKDAPMFVVGVNEHQYKSDV 149          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_ORYSJ (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC PE=1 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 9.434e-59
Identity = 108/146 (73.97%), Postives = 120/146 (82.19%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            MGK+KIGINGFGRIGRLVARV LQ +DVELVAVNDPFITTDYMTYM KYD+VHGQWKH ++K+KD KTLL GEKPVTVFG+RNP+EIPWAE GAEYVVESTGVFT               V+ISAPSKDAPMFV GVNE +Y  ++
Sbjct:    1 MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDI 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_ORYSI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Oryza sativa subsp. indica GN=GAPC PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 9.434e-59
Identity = 108/146 (73.97%), Postives = 120/146 (82.19%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            MGK+KIGINGFGRIGRLVARV LQ +DVELVAVNDPFITTDYMTYM KYD+VHGQWKH ++K+KD KTLL GEKPVTVFG+RNP+EIPWAE GAEYVVESTGVFT               V+ISAPSKDAPMFV GVNE +Y  ++
Sbjct:    1 MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDI 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_MESCR (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Mesembryanthemum crystallinum GN=GAPC PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.232e-58
Identity = 110/146 (75.34%), Postives = 120/146 (82.19%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            M KVK+GINGFGRIGRLVARVILQRDD ELVAVNDPFI+TDYMTYM KYDSVHGQ K HE+K+KD+KTLLFGE PV VFG RNPEEIPW + GA++VVESTGVFT               V+ISAPSKDAPMFVVGVNEHEYK +L
Sbjct:    1 MAKVKVGINGFGRIGRLVARVILQRDDCELVAVNDPFISTDYMTYMFKYDSVHGQCKSHEIKLKDEKTLLFGETPVAVFGCRNPEEIPWGQAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDL 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_PEA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pisum sativum GN=GAPC1 PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 3.585e-58
Identity = 111/143 (77.62%), Postives = 118/143 (82.52%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPE 506
            K+KIGINGFGRIGRLVARV L+RDDVELVAVNDPFITTDYMTYM KYDSVHGQWK+ EL VKD  TLLFG+KPVTVF  RNPEEIPWA TGA+ +VESTGVFT               VIISAPSKDAPMFVVGVNE+EYKPE
Sbjct:    4 KIKIGINGFGRIGRLVARVALKRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKNDELTVKDSNTLLFGQKPVTVFAHRNPEEIPWASTGADIIVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPE 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_TAXBA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Taxus baccata PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 6.115e-58
Identity = 109/145 (75.17%), Postives = 119/145 (82.07%), Query Frame = 3
Query:   75 GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            GK+KIGINGFGRIGRLVARV LQRDD+ELVAVNDPFI+T+ +T + KYDSVHGQWK HE+KVKD+KTLLFGEK V VFG RNPEEIPW E GAEYVVESTGVFT               V+ISAPSKDAPMFVVGVNEHEYK +L
Sbjct:    5 GKIKIGINGFGRIGRLVARVALQRDDIELVAVNDPFISTESLTSLFKYDSVHGQWKKHEVKVKDEKTLLFGEKHVAVFGCRNPEEIPWGEVGAEYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDL 149          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 1 OS=Zea mays GN=GAPC1 PE=2 SV=2)

HSP 1 Score: 223.016 bits (567), Expect = 6.115e-58
Identity = 107/146 (73.29%), Postives = 119/146 (81.51%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            MGK+KIGINGFGRIGRLVARV LQ +DVELVAVNDPFITTDYMTYM KYD+VHG WKH ++ +KD KTLLFG+KPVTVFG+RNPEEIPW E GAEYVVESTGVFT               V+ISAPSKDAPMFVVGVNE +Y  ++
Sbjct:    1 MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGHWKHSDITLKDSKTLLFGDKPVTVFGIRNPEEIPWGEAGAEYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEDKYTSDV 146          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3PX_HORVU1.901e-5975.34Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PE_MAIZE3.242e-5976.03Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PD_MAIZE7.223e-5974.66Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PINSY9.434e-5974.48Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ORYSJ9.434e-5973.97Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ORYSI9.434e-5973.97Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_MESCR1.232e-5875.34Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PEA3.585e-5877.62Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_TAXBA6.115e-5875.17Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_MAIZE6.115e-5873.29Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top